product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 52 Protein E7
catalog :
MBS1049257
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1049257
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 52 Protein E7
products short name :
papillomavirus type 52 Protein E7
other names :
Protein E7; Protein E7
products gene name :
E7
other gene names :
E7
uniprot entry name :
VE7_HPV52
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-99
sequence length :
99
sequence :
MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDG
VDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDL
RTLQQMLLGTLQVVCPGCARL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription.
products references :
Primer-directed sequencing of human papillomavirus types.Delius H., Hofmann B.Curr. Top. Microbiol. Immunol. 186:13-31(1994) Cloning and characterization of human papillomavirus type 52 from cervical carcinoma in Indonesia.Takami Y., Kondoh G., Saito J., Noda K., Sudiro T.M., Sjahrurachman A., Warsa U.C., Yutsudo M., Hakura A.Int. J. Cancer 48:516-522(1991) Interactions of SV40 large T antigen and other viral proteins with retinoblastoma tumour suppressor.Lee C., Cho Y.Rev. Med. Virol. 12:81-92(2002)
ncbi gi num :
549289
ncbi acc num :
P36831.1
uniprot acc num :
P36831
ncbi mol weight :
27.03kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
830
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1055
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!