Recombinant Escherichia coli Lipopolysaccharide export system protein LptA | MyBioSource MBS1049060 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Escherichia coli Lipopolysaccharide export system protein LptA

catalog :

MBS1049060

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1049060

products type :

Recombinant Protein

products full name :

Recombinant Escherichia coli Lipopolysaccharide export system protein LptA

products short name :

Lipopolysaccharide export system protein LptA

other names :

lipopolysaccharide export ABC transporter periplasmic binding protein; Lipid A binding protein; LPS export and assembly protein; Lipopolysaccharide export system protein LptA; lipopolysaccharide export ABC transporter periplasmic binding protein; Lipid A binding protein; LPS export and assembly protein

products gene name :

lptA

other gene names :

lptA; lptA; ECK3189; JW3167; yhbN

uniprot entry name :

LPTA_ECOLI

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

28-185

sequence length :

185

sequence :

VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIK
INADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPV
EGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYL
VKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKK
GN

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.

products references :

Novel proteins of the phosphotransferase system encoded within the rpoN operon of Escherichia coli. Enzyme IIANtr affects growth on organic nitrogen and the conditional lethality of an erats mutant.Powell B.S., Court D.L., Inada T., Nakamura Y., Michotey V., Cui X., Reizer A., Saier M.H. Jr., Reizer J.J. Biol. Chem. 270:4822-4839(1995) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12.Link A.J., Robison K., Church G.M.Electrophoresis 18:1259-1313(1997) Non-essential KDO biosynthesis and new essential cell envelope biogenesis genes in the Escherichia coli yrbG-yhbG locus.Sperandeo P., Pozzi C., Deho G., Polissi A.Res. Microbiol. 157:547-558(2006) Characterization of lptA and lptB, two essential genes implicated in lipopolysaccharide transport to the outer membrane of Escherichia coli.Sperandeo P., Cescutti R., Villa R., Di Benedetto C., Candia D., Deho G., Polissi A.J. Bacteriol. 189:244-253(2007) Functional analysis of the protein machinery required for transport of lipopolysaccharide to the outer membrane of Escherichia coli.Sperandeo P., Lau F.K., Carpentieri A., De Castro C., Molinaro A., Deho G., Silhavy T.J., Polissi A.J. Bacteriol. 190:4460-4469(2008) The LptA protein of Escherichia coli is a periplasmic lipid A-binding protein involved in the lipopolysaccharide export pathway.Tran A.X., Trent M.S., Whitfield C.J. Biol. Chem. 283:20342-20349(2008) Proteins required for lipopolysaccharide assembly in Escherichia coli form a transenvelope complex.Chng S.S., Gronenberg L.S., Kahne D.Biochemistry 49:4565-4567(2010) Characterization of interactions between LPS transport proteins of the Lpt system.Bowyer A., Baardsnes J., Ajamian E., Zhang L., Cygler M.Biochem. Biophys. Res. Commun. 404:1093-1098(2011) New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex.Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A.J. Bacteriol. 193:1042-1053(2011) Regulated assembly of the transenvelope protein complex required for lipopolysaccharide export.Freinkman E., Okuda S., Ruiz N., Kahne D.Biochemistry 51:4800-4806(2012) Novel structure of the conserved Gram-negative lipopolysaccharide transport protein A and mutagenesis analysis.Suits M.D.L., Sperandeo P., Deho G., Polissi A., Jia Z.J. Mol. Biol. 380:476-488(2008)

ncbi gi num :

16131090

ncbi acc num :

NP_417667.1

ncbi gb acc num :

NC_000913.3

uniprot acc num :

P0ADV1

ncbi mol weight :

33.3kD

ncbi summary :

LptA depletion results in rifampicin/bile salts sensitivity, indicative of an outer membrane integrity defect. [More information is available at EcoGene: EG12618]. LptA is a periplasmic binding component of the LptABC ABC transporter. [More information is available at EcoCyc: G7665].

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage