KSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKA
GLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNT
TIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQ
FLA

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Acidovorax ebreus Peptidyl-tRNA hydrolase (pth) | MBS1048944
- Recombinant Escherichia coli Lipopolysaccharide export system protein LptA
- Recombinant Human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
- Recombinant Pasteurella haemolytica Leukotoxin(lktA) | MBS1052036
- Recombinant Macaca mulatta (Rhesus macaque) Cystatin-C (CST3) | MBS1054779