product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr
catalog :
MBS1047376
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1047376
products type :
Recombinant Protein
products full name :
Recombinant Bacillus subtilis (strain 168) Phosphocarrier protein HPr
products short name :
Phosphocarrier protein HPr
products name syn :
Histidine-containing protein
other names :
phosphocarrier protein HPr; Phosphocarrier protein HPr; phosphocarrier protein HPr; Histidine-containing protein
products gene name :
ptsH
other gene names :
ptsH; ptsH
uniprot entry name :
PTHP_BACSU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Feb-88
sequence length :
88
sequence :
AQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGK
TVNLKSIMGVMSLGIAKGAEITISASGADENDALNALEE
TMKSEGLGE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Bacillus subtilis (strain 168)
products description :
General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III). P-Ser-HPr interacts with the catabolite control protein A (CcpA), forming a complex that binds to DNA at the catabolite response elements cre, operator sites preceding a large number of catabolite-regulated genes. Thus, P-Ser-HPr is a corepressor in carbon catabolite repression (CCR), a mechanism that allows bacteria to coordinate and optimize the utilization of available carbon sources. P-Ser-HPr also plays a role in inducer exclusion, in which it probably interacts with several non-PTS permeases and inhibits their transport activity.
products references :
Phosphoenolpyruvate:sugar phosphotransferase system of Bacillus subtilis: nucleotide sequence of ptsX, ptsH and the 5'-end of ptsI and evidence for a ptsHI operon." Gonzy-Treboul G., Zagorec M., Rain-Guion M.-C., Steinmetz M. Mol. Microbiol. 3:103-112(1989)
ncbi gi num :
16078454
ncbi acc num :
NP_389273.1
ncbi gb acc num :
NC_000964.3
uniprot acc num :
P08877
ncbi mol weight :
25.05kD
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.5 mg (E-Coli)
price4 :
750
size5 :
0.05 mg (Baculovirus)
price5 :
820
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!