protein

Recombinant Salmonella typhi 3-dehydroquinate dehydratase

MBS1047153

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Salmonella typhi 3-dehydroquinate dehydratase

3-dehydroquinate dehydratase

Type I DHQase

3-dehydroquinate dehydratase; 3-dehydroquinate dehydratase; Type I DHQase

aroD

aroD; aroD; DHQ1

AROD_SALTI

E Coli or Yeast or Baculovirus or Mammalian Cell

1-252

252

MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYRE
ATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLL
FTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLEL
FTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVL
RLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY
ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAP
GQIAVNDLRSVLMILHNA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.

Molecular cloning and characterization of the aroD gene encoding 3-dehydroquinase from Salmonella typhi.Servos S., Chatfield S., Hone D., Levine M., Dimitriadis G., Pickard D., Dougan G., Fairweather N., Charles I.G.J. Gen. Microbiol. 137:147-152(1991) Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18.Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P., Davies R.M., Dowd L., White N., Farrar J., Feltwell T., Hamlin N., Haque A., Hien T.T., Holroyd S., Jagels K., Krogh A., Larsen T.S., Leather S., Moule S., O'Gaora P., Parry C., Quail M.A., Rutherford K.M., Simmonds M., Skelton J., Stevens K., Whitehead S., Barrell B.G.Nature 413:848-852(2001) Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18.Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003) The two types of 3-dehydroquinase have distinct structures but catalyze the same overall reaction.Gourley D.G., Shrive A.K., Polikarpov I., Krell T., Coggins J.R., Hawkins A.R., Isaacs N.W., Sawyer L.Nat. Struct. Biol. 6:521-525(1999) Comparison of different crystal forms of 3-dehydroquinase from Salmonella typhi and its implication for the enzyme activity.Lee W.H., Perles L.A., Nagem R.A., Shrive A.K., Hawkins A., Sawyer L., Polikarpov I.Acta Crystallogr. D 58:798-804(2002) Insights into substrate binding and catalysis in bacterial type I dehydroquinase.Maneiro M., Peon A., Lence E., Otero J.M., Van Raaij M.J., Thompson P., Hawkins A.R., Gonzalez-Bello C.Biochem. J. 462:415-424(2014)

NP_456161.1

P24670

43.63kD

Biosynthesis Of Amino Acids Pathway (791477); Biosynthesis Of Amino Acids Pathway (795174); Biosynthesis Of Antibiotics Pathway (1146467); Biosynthesis Of Secondary Metabolites Pathway (148745); Metabolic Pathways (132060); Phenylalanine, Tyrosine And Tryptophan Biosynthesis Pathway (6355); Phenylalanine, Tyrosine And Tryptophan Biosynthesis Pathway (333); Shikimate Pathway, Phosphoenolpyruvate + Erythrose-4P = Chorismate (447591); Shikimate Pathway, Phosphoenolpyruvate + Erythrose-4P = Chorismate (468215)

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750