catalog number :
MBS1047153
products type :
Recombinant Protein
products full name :
Recombinant Salmonella typhi 3-dehydroquinate dehydratase
products short name :
3-dehydroquinate dehydratase
products name syn :
Type I DHQase
other names :
3-dehydroquinate dehydratase; 3-dehydroquinate dehydratase; Type I DHQase
products gene name :
aroD
other gene names :
aroD; aroD; DHQ1
uniprot entry name :
AROD_SALTI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-252
sequence :
MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYRE
ATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLL
FTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLEL
FTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVL
RLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY
ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAP
GQIAVNDLRSVLMILHNA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Involved in the third step of the chorismate pathway, which leads to the biosynthesis of aromatic amino acids. Catalyzes the cis-dehydration of 3-dehydroquinate (DHQ) and introduces the first double bond of the aromatic ring to yield 3-dehydroshikimate. The reaction involves the formation of an imine intermediate between the keto group of 3-dehydroquinate and the epsylon-amino group of Lys-170 at the active site.
products references :
Molecular cloning and characterization of the aroD gene encoding 3-dehydroquinase from Salmonella typhi.Servos S., Chatfield S., Hone D., Levine M., Dimitriadis G., Pickard D., Dougan G., Fairweather N., Charles I.G.J. Gen. Microbiol. 137:147-152(1991)
Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18.Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P., Davies R.M., Dowd L., White N., Farrar J., Feltwell T., Hamlin N., Haque A., Hien T.T., Holroyd S., Jagels K., Krogh A., Larsen T.S., Leather S., Moule S., O'Gaora P., Parry C., Quail M.A., Rutherford K.M., Simmonds M., Skelton J., Stevens K., Whitehead S., Barrell B.G.Nature 413:848-852(2001)
Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18.Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003)
The two types of 3-dehydroquinase have distinct structures but catalyze the same overall reaction.Gourley D.G., Shrive A.K., Polikarpov I., Krell T., Coggins J.R., Hawkins A.R., Isaacs N.W., Sawyer L.Nat. Struct. Biol. 6:521-525(1999)
Comparison of different crystal forms of 3-dehydroquinase from Salmonella typhi and its implication for the enzyme activity.Lee W.H., Perles L.A., Nagem R.A., Shrive A.K., Hawkins A., Sawyer L., Polikarpov I.Acta Crystallogr. D 58:798-804(2002)
Insights into substrate binding and catalysis in bacterial type I dehydroquinase.Maneiro M., Peon A., Lence E., Otero J.M., Van Raaij M.J., Thompson P., Hawkins A.R., Gonzalez-Bello C.Biochem. J. 462:415-424(2014)
ncbi acc num :
NP_456161.1
ncbi mol weight :
43.63kD
ncbi pathways :
Biosynthesis Of Amino Acids Pathway (791477); Biosynthesis Of Amino Acids Pathway (795174); Biosynthesis Of Antibiotics Pathway (1146467); Biosynthesis Of Secondary Metabolites Pathway (148745); Metabolic Pathways (132060); Phenylalanine, Tyrosine And Tryptophan Biosynthesis Pathway (6355); Phenylalanine, Tyrosine And Tryptophan Biosynthesis Pathway (333); Shikimate Pathway, Phosphoenolpyruvate + Erythrose-4P = Chorismate (447591); Shikimate Pathway, Phosphoenolpyruvate + Erythrose-4P = Chorismate (468215)