product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4
catalog :
MBS1045370
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1045370
products type :
Recombinant Protein
products full name :
Recombinant Centruroides suffusus suffusus (Mexican scorpion) Beta-mammal toxin Css4
products short name :
Beta-mammal toxin Css4
other names :
Beta-mammal toxin Css4; Beta-mammal toxin Css4; Css IV; CssIV
products gene name :
CssIV
other gene names :
CssIV; CssIV
uniprot entry name :
SCX4_CENSU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-66, Full length.
sequence length :
66
sequence :
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGG
YCYAFGCWCTHLYEQAVVWPLPNKTCN
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.
products references :
Scorpion toxins specific for Na+-channels.Possani L.D., Becerril B., Delepierre M., Tytgat J.Eur. J. Biochem. 264:287-300(1999) Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusus.Martin M.-F., Garcia Y., Perez L.G., el Ayeb M., Kopeyan C., Bechis G., Jover E., Rochat H.J. Biol. Chem. 262:4452-4459(1987) Voltage sensor-trapping enhanced activation of sodium channels by beta-scorpion toxin bound to the S3-S4 loop in domain II.Cestele S., Qu Y., Rogers J.C., Rochat H., Scheuer T., Catterall W.A.Neuron 21:919-931(1998) Neutralization of gating charges in domain II of the sodium channel alpha subunit enhances voltage-sensor trapping by a beta-scorpion toxin.Cestele S., Scheuer T., Mantegazza M., Rochat H., Catterall W.A.J. Gen. Physiol. 118:291-302(2001) Common features in the functional surface of scorpion beta-toxins and elements that confer specificity for insect and mammalian voltage-gated sodium channels.Cohen L., Karbat I., Gilles N., Ilan N., Benveniste M., Gordon D., Gurevitz M.J. Biol. Chem. 280:5045-5053(2005) X-ray structure and mutagenesis of the scorpion depressant toxin LqhIT2 reveals key determinants crucial for activity and anti-insect selectivity.Karbat I., Turkov M., Cohen L., Kahn R., Gordon D., Gurevitz M., Frolow F.J. Mol. Biol. 366:586-601(2007)
ncbi gi num :
41017880
ncbi acc num :
P60266.1
uniprot acc num :
P60266
ncbi mol weight :
23.61kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
795
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1020
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!