product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Escherichia coli Cytidylate kinase
catalog :
MBS1045029
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1045029
products type :
Recombinant Protein
products full name :
Recombinant Escherichia coli Cytidylate kinase
products short name :
Cytidylate kinase
products name syn :
Cytidine monophosphate kinase; CMP kinase; Protein MssA; p25
other names :
cytidylate kinase; Cytidylate kinase; cytidylate kinase; Cytidine monophosphate kinase; CMP kinase; Protein MssA; p25
products gene name :
cmk
other gene names :
cmk; cmk; ECK0901; JW0893; mssA; ycaF; ycaG; mssA; ycaF; ycaG; CK; CMP kinase
uniprot entry name :
KCY_ECOLI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-227
sequence length :
227
sequence :
MTAIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAI
YRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNL
EVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQ
RAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAH
RRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVP
AADALVLDSTTLSIEQVIEKALQYARQKLALA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
ATP, dATP, and GTP are equally effective as phosphate donors. CMP and dCMP are the best phosphate acceptors.
products references :
Transcriptional organization of the rpsA operon of Escherichia coli.Pedersen S., Skouv J., Kajitani M., Ishihama A.Mol. Gen. Genet. 196:135-140(1984) A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map.Oshima T., Aiba H., Baba T., Fujita K., Hayashi K., Honjo A., Ikemoto K., Inada T., Itoh T., Kajihara M., Kanai K., Kashimoto K., Kimura S., Kitagawa M., Makino K., Masuda S., Miki T., Mizobuchi K., Mori H., Motomura K., Nakamura Y., Nashimoto H., Nishio Y., Saito N., Sampei G., Seki Y., Tagami H., Takemoto K., Wada C., Yamamoto Y., Yano M., Horiuchi T.DNA Res. 3:137-155(1996) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) The DNA sequence of the gene rpsA of Escherichia coli coding for ribosomal protein S1.Schnier J., Isono K.Nucleic Acids Res. 10:1857-1865(1982) Multicopy suppressors, mssA and mssB, of an smbA mutation of Escherichia coli.Yamanaka K., Ogura T., Koonin E.V., Niki H., Hiraga S.Mol. Gen. Genet. 243:9-16(1994) The cmk gene encoding cytidine monophosphate kinase is located in the rpsA operon and is required for normal replication rate in Escherichia coli.Fricke J., Neuhard J., Kelln R.A., Pedersen S.J. Bacteriol. 177:517-523(1995) Structural and catalytic properties of CMP kinase from Bacillus subtilis a comparative analysis with the homologous enzyme from Escherichia coli.Schultz C.P., Ylisastigui-Pons L., Serina L., Sakamoto H., Mantsch H.H., Neuhard J., Barzu O., Gilles A.M.Arch. Biochem. Biophys. 340:144-153(1997) Structures of Escherichia coli CMP kinase alone and in complex with CDP a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.Briozzo P., Golinelli-Pimpaneau B., Gilles A.M., Gaucher J.F., Burlacu-Miron S., Sakamoto H., Janin J., Barzu O.Structure 6:1517-1527(1998)
ncbi gi num :
16128877
ncbi acc num :
NP_415430.1
ncbi gb acc num :
NC_000913.3
uniprot acc num :
P0A6I0
ncbi mol weight :
40.73kD
ncbi pathways :
CMP Phosphorylation Pathway (782453); CMP Phosphorylation Pathway (908070); Metabolic Pathways (131985); Pyrimidine Metabolism Pathway (1023); Pyrimidine Metabolism Pathway (309); Pyrimidine Ribonucleotide Biosynthesis, UMP = UDP/UTP,CDP/CTP Pathway (405191); Pyrimidine Ribonucleotide Biosynthesis, UMP = UDP/UTP,CDP/CTP Pathway (468245); Pyrimidine Deoxyribonucleotide Phosphorylation Pathway (782452); Pyrimidine Deoxyribonucleotide Phosphorylation Pathway (907959); Salvage Pathways Of Pyrimidine Ribonucleotides (120)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
980
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!