product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Ephrin-B3
catalog :
MBS1044476
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1044476
products type :
Recombinant Protein
products full name :
Recombinant Mouse Ephrin-B3
products short name :
Ephrin-B3
other names :
ephrin-B3; Ephrin-B3; ephrin-B3; ephrin B3
products gene name :
Efnb3
other gene names :
Efnb3; Efnb3; Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
uniprot entry name :
EFNB3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
28-227
sequence length :
340
sequence :
LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRAR
PPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCD
RPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGT
REGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSE
MPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPP
PSMPA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
products references :
Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.Bergemann A.D., Zhang L., Chiang M.-K., Brambilla R., Klein R., Flanagan J.G.Oncogene 16:471-480(1998) Complementary expression of transmembrane ephrins and their receptors in the mouse spinal cord a possible role in constraining the orientation of longitudinally projecting axons.Imondi R., Wideman C., Kaprielian Z.Development 127:1397-1410(2000) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009)
ncbi gi num :
6681281
ncbi acc num :
NP_031937.1
ncbi gb acc num :
NM_007911.5
uniprot acc num :
O35393
ncbi mol weight :
26.1kD
ncbi pathways :
Axon Guidance Pathway (83262); Axon Guidance Pathway (476); Axon Guidance Pathway (1323598); Developmental Biology Pathway (1323597); EPH-Ephrin Signaling Pathway (1323624); EPH-ephrin Mediated Repulsion Of Cells Pathway (1323628); EPHB-mediated Forward Signaling Pathway (1323626); Ephrin Signaling Pathway (1323627); XPodNet - Protein-protein Interactions In The Podocyte Expanded By STRING Pathway (755427)
uniprot summary :
EFNB3: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons. Belongs to the ephrin family. Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase; Cell development/differentiation. Cellular Component: integral to membrane; membrane; plasma membrane. Molecular Function: ephrin receptor binding. Biological Process: adult walking behavior; axon choice point recognition; axon guidance; cell differentiation; ephrin receptor signaling pathway; multicellular organismal development; nervous system development; T cell costimulation
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!