catalog number :
MBS1044305
products type :
Recombinant Protein
products full name :
Recombinant Canine distemper virus (strain Onderstepoort) (CDV) Fusion glycoprotein F0
products short name :
Fusion glycoprotein F0
other names :
Fusion glycoprotein F0; Fusion glycoprotein F0
uniprot entry name :
FUS_CDVO
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
136-608, Partial, provide the complete extracellular domain.
sequence :
QIHWDNLSTIGIIGTDNVHYKIMTRPSHQYLVIKLIPNA
SLIENCTKAELGEYEKLLNSVLEPINQALTLMTKNVKPL
QSLGSGRRQRRFAGVVLAGVALGVATAAQITAGIALHQS
NLNAQAIQSLRTSLEQSNKAIEEIREATQETVIAVQGVQ
DYVNNELVPAMQHMSCELVGQRLGLRLLRYYTELLSIFG
PSLRDPISAEISIQALIYALGGEIHKILEKLGYSGSDMI
AILESRGIKTKITHVDLPGKFIILSISYPTLSEVKGVIV
HRLEAVSYNIGSQEWYTTVPRYIATNGYLISNFDESSCV
FVSESAICSQNSLYPMSPLLQQCIRGDTSSCARTLVSGT
MGNKFILSKGNIVANCASILCKCYSTSTIINQSPDKLLT
FIASDTCPLVEIDGATIQVGGRQYPDMVYEGKVALGPAI
SLDRLDVGTNLGNALKKLDDAKVLIDSSNQILETVRRSS
FNFGS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and plasma cell membrane fusion, the heptad repeat (HR) regions assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and plasma cell membranes. Directs fusion of viral and cellular membranes leading to delivery of the nucleocapsid into the cytoplasm. This fusion is pH independent and occurs directly at the outer cell membrane. The trimer of F1-F2 (F protein) probably interacts with H at the virion surface. Upon HN binding to its cellular receptor, the hydrophobic fusion peptide is unmasked and interacts with the cellular membrane, inducing the fusion between cell and virion membranes. Later in infection, F proteins expressed at the plasma membrane of infected cells could mediate fusion with adjacent cells to form syncytia, a cytopathic effect that could lead to tissue necrosis.
products references :
The nucleotide sequence of the gene encoding the F protein of canine distemper virus
a comparison of the deduced amino acid sequence with other paramyxoviruses.Barrett T., Clarke D.K., Evans S.A., Rima B.K.Virus Res. 8:373-386(1987)
Vaccination of mice against canine distemper virus-induced encephalitis with vaccinia virus recombinants encoding measles or canine distemper virus antigens.Wild T.F., Bernard A., Spehner D., Villeval D., Drillien R.Vaccine 11:438-444(1993)
Amino-terminal precursor sequence modulates canine distemper virus fusion protein function.von Messling V., Cattaneo R.J. Virol. 76:4172-4180(2002)
size4 :
0.05 mg (Baculovirus)
size5 :
0.05 mg (Mammalian-Cell)