PPSNKRTRNPSPERATTSSEADVGRKTQKKQTPTEIKKS
VYNMVVKLGEFYNQMMVKAGLNDDMERNLIQNAHAVERI
LLAATDDKKTEFQKKKNARDVKEGKEEIDHNKTGGTFYK
MVRDDKTIYFSP

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse Serum amyloid A-3 protein | MBS1043052
- Recombinant Danio rerio D-2-hydroxyglutarate dehydrogenase, mitochondrial
- Recombinant Carpinus betulus Major pollen allergen Car b 1 isoform 2 | MBS1043940
- Recombinant Canine distemper virus (strain Onderstepoort) (CDV) Fusion glycoprot ...
- Recombinant Mouse Ephrin-B3 | MBS1044476