product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Influenza B virus Nucleoprotein
catalog :
MBS1043024
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1043024
products type :
Recombinant Protein
products full name :
Recombinant Influenza B virus Nucleoprotein
products short name :
Influenza B virus Nucleoprotein
products name syn :
Nucleocapsid protein; Protein N
other names :
Nucleoprotein; Nucleoprotein; Nucleocapsid protein; Protein N
products gene name :
NP
other gene names :
NP; Protein N
uniprot entry name :
NCAP_INBSI
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-168
sequence length :
560
sequence :
MSNMDIDGINTGTIDKTPEEIISGTSGATRPIIRPATLA
PPSNKRTRNPSPERATTSSEADVGRKTQKKQTPTEIKKS
VYNMVVKLGEFYNQMMVKAGLNDDMERNLIQNAHAVERI
LLAATDDKKTEFQKKKNARDVKEGKEEIDHNKTGGTFYK
MVRDDKTIYFSP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Encapsidates the negative strand viral RNA, protecting it from nucleases. The encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication. The RNP needs to be localized in the nucleus to start an infectious cycle, but is too large to diffuse through the nuclear pore complex. NP comprises at least 2 nuclear localization signals and is responsible of the active RNP import into the nucleus through the cellular importin alpha/beta pathway. Later in the infection, nucleus export of RNP are mediated through viral proteins NEP interacting with M1 which binds nucleoproteins. It is possible that the nucleoprotein binds directly exportin-1 (XPO1) and plays an active role in RNP nuclear export. M1 interaction with RNP ses to hide nucleoprotein's nuclear localization signals. Soon after a virion infects a new cell, M1 dissociates from the RNP under acidification of the virion driven by M2 protein. Dissociation of M1 from RNP unmask nucleoprotein's nuclear localization signals, targeting the RNP to the nucleus.
products references :
Complete nucleotide sequence of the nucleoprotein gene of influenza B virus.Londo D.R., Davis A.R., Nayak D.P.J. Virol. 47:642-648(1983)
ncbi gi num :
139120
ncbi acc num :
P04666.1
uniprot acc num :
P04666
ncbi mol weight :
46.2kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!