Recombinant Human Leukocyte cell-derived chemotaxin 1 | MyBioSource MBS1042353 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Leukocyte cell-derived chemotaxin 1

catalog :

MBS1042353

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1042353

products type :

Recombinant Protein

products full name :

Recombinant Human Leukocyte cell-derived chemotaxin 1

products short name :

Leukocyte cell-derived chemotaxin 1

products name syn :

Cleaved into the following 2 chains: 1. Chondrosurfactant protein; 2. CH-SP 3. Chondromodulin-1; Chondromodulin-I; ChM-I

other names :

leukocyte cell-derived chemotaxin 1 isoform 2; Leukocyte cell-derived chemotaxin 1; leukocyte cell-derived chemotaxin 1; leukocyte cell derived chemotaxin 1; Chondrosurfactant protein; CH-SP

products gene name :

LECT1

other gene names :

LECT1; LECT1; CHM1; CHM-I; BRICD3; MYETS1; CHMI; CH-SP; ChM-I

uniprot entry name :

LECT1_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

215-334

sequence length :

333

sequence :

EVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDS
QAFNPDNPYHQEGESMTFDPRLDHEGICCIECRRSYTHC
QKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILG
MV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cancer

products description :

Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization.

products references :

Expression of cartilage-specific functional matrix chondromodulin-I mRNA in rabbit growth plate chondrocytes and its responsiveness to growth stimuli in vitro." Shukunami C., Hiraki Y. Biochem. Biophys. Res. Commun. 249:885-890(1998)

ncbi gi num :

59806343

ncbi acc num :

NP_001011705.1

ncbi gb acc num :

NM_001011705.1

uniprot acc num :

O75829

ncbi mol weight :

29.62kD

ncbi summary :

This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

uniprot summary :

LECT1: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. Belongs to the chondromodulin-1 family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Cell development/differentiation; Membrane protein, integral. Chromosomal Location of Human Ortholog: 13q14.3. Cellular Component: endomembrane system; integral to membrane; proteinaceous extracellular matrix. Biological Process: cartilage development; endothelial cell morphogenesis; negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; negative regulation of vascular endothelial growth factor receptor signaling pathway; proteoglycan metabolic process; skeletal development

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage