Recombinant Human Probable ATP-dependent RNA helicase DDX58 | MyBioSource MBS1040007 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Probable ATP-dependent RNA helicase DDX58

catalog :

MBS1040007

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1040007

products type :

Recombinant Protein

products full name :

Recombinant Human Probable ATP-dependent RNA helicase DDX58

products short name :

Probable ATP-dependent RNA helicase DDX58

products name syn :

DEAD box protein 58; RIG-I-like receptor 1; RLR-1; Retinoic acid-inducible gene 1 protein; RIG-1; Retinoic acid-inducible gene I protein; RIG-I

other names :

probable ATP-dependent RNA helicase DDX58; Probable ATP-dependent RNA helicase DDX58; probable ATP-dependent RNA helicase DDX58; DEXD/H-box helicase 58; DEAD box protein 58; RIG-I-like receptor 1; RLR-1; Retinoic acid-inducible gene 1 protein; RIG-1; Retinoic acid-inducible gene I protein; RIG-I

products gene name :

DDX58

other gene names :

DDX58; DDX58; RIGI; RIG-I; RLR-1; SGMRT2; RLR-1; RIG-1; RIG-I

uniprot entry name :

DDX58_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-430, partial, include the Helicase ATP-binding domain?CARD 1 domain ? CARD 2 domain ?

sequence length :

430

sequence :

MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQ
YIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALD
HAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTR
IIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLV
ECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDV
ETEDLEDKMETSDIQIFYQEDPECQNLSENSCPPSEVSD
TNLYSPFKPRNYQLELALPAMKGKNTIICAPTGCGKTFV
SLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSK
YFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQIL
VNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNY
LDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICK
L

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Immunology

products description :

Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include: 5'-triphosphorylated ssRNA and dsRNA and short dsRNA ( 1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the 5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Detects both positive and negative strand RNA viruses including mbers of the families Paramyxoviridae: Human respiratory syncytial virus and measles virus (MeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotavirus and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration

products references :

RIG-I, a human homolog gene of RNA helicase, is induced by retinoic acid during the differentiation of acute promyelocytic leukemia cell.Sun Y.-W.Thesis (1997) , Shanghai Institute of Hematology, ChinaRetinoic acid-inducible gene-I is induced in endothelial cells by LPS and regulates expression of COX-2.Imaizumi T., Aratani S., Nakajima T., Carlson M., Matsumiya T., Tanji K., Ookawa K., Yoshida H., Tsuchida S., McIntyre T.M., Prescott S.M., Zimmerman G.A., Satoh K.Biochem. Biophys. Res. Commun. 292:274-279(2002) DNA sequence and analysis of human chromosome 9.Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.Nature 429:369-374(2004)

ncbi gi num :

27881482

ncbi acc num :

NP_055129.2

ncbi gb acc num :

NM_014314.3

uniprot acc num :

O95786

ncbi mol weight :

53.3kD

ncbi pathways :

Antiviral Mechanism By IFN-stimulated Genes Pathway (1269316); Cytokine Signaling In Immune System Pathway (1269310); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Epstein-Barr Virus Infection Pathway (585562); Epstein-Barr Virus Infection Pathway (587115); Hepatitis B Pathway (694606); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Herpes Simplex Infection Pathway (377873)

ncbi summary :

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of immune response. [provided by RefSeq, Jul 2008]

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1170

more info or order :

MyBioSource product webpage