product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Orexin receptor type 2
catalog :
MBS1038575
quantity :
INQUIRE
price :
INQUIRE
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1038575
products type :
Recombinant Protein
products full name :
Recombinant Human Orexin receptor type 2
products short name :
Orexin receptor type 2
products name syn :
Hypocretin receptor type 2
other names :
orexin receptor type 2; Orexin receptor type 2; orexin receptor type 2; hypocretin receptor 2; Hypocretin receptor type 2
products gene name :
HCRTR2
other gene names :
HCRTR2; HCRTR2; OX2R; Ox-2-R; Ox2-R; Ox2R
uniprot entry name :
OX2R_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-75
sequence length :
444
sequence :
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEF
LRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Homo sapiens
products categories :
Cardiovascular
products description :
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides.
products references :
Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior." Sakurai T., Amemiya A., Ishii M., Matsuzaki I., Chemelli R.M., Tanaka H., Williams S.C., Richardson J.A., Kozlowski G.P., Wilson S., Arch J.R.S., Buckingham R.E., Haynes A.C., Carr S.A., Annan R.S., McNulty D.E., Liu W.-S., Terrett J.A. Yanagisawa M. Cell 92:573-585(1998)
ncbi gi num :
222080109
ncbi acc num :
NP_001517.2
ncbi gb acc num :
NM_001526.3
uniprot acc num :
O43614
ncbi mol weight :
10.81kD
ncbi pathways :
Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1269592); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462); Orexin And Neuropeptides FF And QRFP Bind To Their Respective Receptors Pathway (1269550); Peptide Ligand-binding Receptors Pathway (1269546)
ncbi summary :
The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq, Jan 2009]
uniprot summary :
HCRTR2: Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Belongs to the G-protein coupled receptor 1 family. Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1. Chromosomal Location of Human Ortholog: 6p12. Cellular Component: integral to plasma membrane; plasma membrane. Molecular Function: neuropeptide receptor activity; orexin receptor activity; peptide binding; peptide hormone binding. Biological Process: cellular response to hormone stimulus; circadian sleep/wake cycle process; feeding behavior; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); neuropeptide signaling pathway; regulation of circadian sleep/wake cycle, sleep; synaptic transmission
size1 :
INQUIRE
price1 :
INQUIRE
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!