HLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDN
GPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNG
PHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMT
DGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGP
VQLSYYD

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Dactylis glomerata (Orchard grass) Pollen allergen Dac g 3
- Recombinant Human Probable ATP-dependent RNA helicase DDX58 | MBS1040007
- Recombinant Human 2-5A-dependent ribonuclease (RNASEL) | MBS1041064
- Recombinant Aequorea victoria (Jellyfish) Green fluorescent protein | MBS1041284
- Recombinant Escherichia coli Glutamate--cysteine ligase | MBS1042315