Recombinant Human Interferon alpha-2 | MyBioSource MBS1036500 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Interferon alpha-2

catalog :

MBS1036500

quantity :

0.05 mg (E-Coli)

price :

175 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1036500

products type :

Recombinant Protein

products full name :

Recombinant Human Interferon alpha-2

products short name :

Interferon alpha-2

products name syn :

Interferon alpha-A; LeIF A

other names :

interferon alpha-2; Interferon alpha-2; interferon alpha-2; interferon, alpha 2; Interferon alpha-A; LeIF A

products gene name :

IFNA2

other gene names :

IFNA2; IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA; IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A

uniprot entry name :

IFNA2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-188

sequence length :

188

sequence :

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFP
QEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDE
TLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL
AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTN
LQESLRSKE

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cancer

products description :

Produced by macrophages, IFN-alpha have antiviral activities.

products references :

Human leukocyte interferon produced by E. coli is biologically active.Goeddel D.V., Yelverton E., Ullrich A., Heyneker H.L., Miozzari G., Holmes W., Seeburg P.H., Dull T.J., May L., Stebbing N., Crea R., Maeda S., McCandliss R., Sloma A., Tabor J.M., Gross M., Familletti P.C., Pestka S.Nature 287:411-416(1980) The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) DNA sequence of a major human leukocyte interferon gene.Lawn R.M., Gross M., Houck C.M., Franke A.E., Gray P.V., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 78:5435-5439(1981) Cloning of human leukocyte interferon cDNA and a strategy for its production in E. coli.Oliver G., Balbas P., Valle F., Soberon X., Bolivar F.Rev. Latinoam. Microbiol. 27:141-150(1985) A defective retroviral vector encoding human interferon alpha 2 can transduce human leukemic cell lines.Austruy E., Bagnis C., Carbuccia N., Maroc C., Birg F., Dubreuil P., Mannoni P., Chabannon C.Cancer Gene Ther. 5:247-256(1998) Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b.Gull I., Samra Z.Q., Aslam M.S., Athar M.A.Springerplus 2:264-264(2013) Hanif K., Noor S., Naveed Y., Bashir B., Hussain T., Kanwal N. Intermolecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric reverse-protonation and two-dimensional NOESY.Nudelman I., Akabayov S.R., Schnur E., Biron Z., Levy R., Xu Y., Yang D., Anglister J.Biochemistry 49:5117-5133(2010) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

ncbi gi num :

11067751

ncbi acc num :

NP_000596.2

ncbi gb acc num :

NM_000605.3

uniprot acc num :

P01563

ncbi mol weight :

46.6kD

ncbi pathways :

Autoimmune Thyroid Disease Pathway (83121); Autoimmune Thyroid Disease Pathway (533); Cytokine Signaling In Immune System Pathway (1269310); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833); Factors Involved In Megakaryocyte Development And Platelet Production Pathway (1269377); Hemostasis Pathway (1269340); Hepatitis B Pathway (694606)

ncbi summary :

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]

uniprot summary :

IFNA2: Produced by macrophages, IFN-alpha have antiviral activities. Belongs to the alpha/beta interferon family. Protein type: Secreted; Membrane protein, integral; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 9p22. Cellular Component: extracellular region; extracellular space. Molecular Function: cytokine activity; interferon-alpha/beta receptor binding; protein binding. Biological Process: adaptive immune response; apoptosis; B cell differentiation; B cell proliferation; blood coagulation; cell surface receptor linked signal transduction; cell-cell signaling; cytokine and chemokine mediated signaling pathway; defense response to virus; humoral immune response; inflammatory response; innate immune response; natural killer cell activation during immune response; negative regulation of T cell differentiation; negative regulation of transcription, DNA-dependent; negative regulation of virion penetration into host cell; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of phosphorylation; positive regulation of transcription, DNA-dependent; positive regulation of tyrosine phosphorylation of Stat3 protein; response to exogenous dsRNA; T cell activation during immune response

size1 :

0.05 mg (E-Coli)

price1 :

175 USD

size2 :

0.05 mg (Yeast)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

295

size4 :

0.2 mg (Yeast)

price4 :

460

size5 :

0.5 mg (E-Coli)

price5 :

580

more info or order :

MyBioSource product webpage