product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 26S proteasome regulatory subunit RPN13
catalog :
MBS1036084
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1036084
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 26S proteasome regulatory subunit RPN13
products short name :
26S proteasome regulatory subunit RPN13
products name syn :
Proteasome non-ATPase subunit 13
other names :
26S proteasome regulatory subunit RPN13; proteasome regulatory particle lid subunit RPN13; Proteasome non-ATPase subunit 13
products gene name :
RPN13
other gene names :
RPN13; RPN13; DAQ1
uniprot entry name :
RPN13_YEAST
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-156
sequence length :
154
sequence :
SMSSTVIKFRAGVCEYNEDSRLCTPIPVQGEIEIKPNEE
EELGFWDFEWRPTEKPVGRELDPISLILIPGETMWVPIK
SSKSGRIFALVFSSNERYFFWLQEKNSGNLPLNELSAKD
KEIYNKMIGVLNNSSESDEEESNDEKQKAQDVDVSMQD
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Component of the 19S cap proteasome complex which acts as a regulatory subunit of the 26S proteasome, involved in the ATP-dependent degradation of ubiquitinated proteins.
products references :
The nucleotide sequence of Saccharomyces cerevisiae chromosome XII.Johnston M., Hillier L.W., Riles L., Albermann K., Andre B., Ansorge W., Benes V., Brueckner M., Delius H., Dubois E., Duesterhoeft A., Entian K.-D., Floeth M., Goffeau A., Hebling U., Heumann K., Heuss-Neitzel D., Hilbert H., Hilger F., Kleine K., Koetter P., Louis E.J., Messenguy F., Mewes H.-W., Miosga T., Moestl D., Mueller-Auer S., Nentwich U., Obermaier B., Piravandi E., Pohl T.M., Portetelle D., Purnelle B., Rechmann S., Rieger M., Rinke M., Rose M., Scharfe M., Scherens B., Scholler P., Schwager C., Schwarz S., Underwood A.P., Urrestarazu L.A., Vandenbol M., Verhasselt P., Vierendeels F., Voet M., Volckaert G., Voss H., Wambutt R., Wedler E., Wedler H., Zimmermann F.K., Zollner A., Hani J., Hoheisel J.D.Nature 387:87-90(1997) ) Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.Hu Y., Rolfs A., Bhullar B., Murthy T.V.S., Zhu C., Berger M.F., Camargo A.A., Kelley F., McCarron S., Jepson D., Richardson A., Raphael J., Moreira D., Taycher E., Zuo D., Mohr S., Kane M.F., Williamson J., Simpson A.J.G., Bulyk M.L., Harlow E., Marsischky G., Kolodner R.D., LaBaer J.Genome Res. 17:536-543(2007) The 26S proteasome of the yeast Saccharomyces cerevisiae.Fischer M., Hilt W., Richter-Ruoff B., Gonen H., Ciechanover A., Wolf D.H.FEBS Lett. 355:69-75(1994)
ncbi acc num :
NP_013525.3
uniprot acc num :
O13563
ncbi mol weight :
33.76kD
ncbi pathways :
Proteasome Pathway (949); Proteasome Pathway (445); Proteasome, 19S Regulatory Particle (PA700) Pathway (438677); Proteasome, 19S Regulatory Particle (PA700) Pathway (890593)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
895
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1120
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!