product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Murinoglobulin-1
catalog :
MBS1035048
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1035048
products type :
Recombinant Protein
products full name :
Recombinant Mouse Murinoglobulin-1
products short name :
Murinoglobulin-1
other names :
murinoglobulin-1; Murinoglobulin-1; murinoglobulin-1; murinoglobulin 1
products gene name :
Mug1
other gene names :
Mug1; Mug1; Mug-1; MuG1
uniprot entry name :
MUG1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
700-910
sequence length :
1476
sequence :
TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFP
ETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSND
TGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATV
MNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGR
HTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPE
TGRKDTVVKVLIVEPE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
A proteinase activates the inhibitor by specific proteolysis in the bait region, which, by an unknown mechanism leads to reaction at the cysteinyl-glutamyl internal thiol ester site and to a conformational change, whereby the proteinase is trapped and/or covalently bound to the inhibitor. While in the tetrameric proteinase inhibitors steric inhibition is sufficiently strong, monomeric forms need a covalent linkage between the activated glutamyl residue of the original thiol ester and a terminal amino group of a lysine or another nucleophilic group on the proteinase, for inhibition to be effective.
products references :
Molecular characterization of the murinoglobulins.Overbergh L., Torrekens S., van Leuven F., van den Berghe H.J. Biol. Chem. 266:16903-16910(1991) Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006) Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)
ncbi gi num :
31982171
ncbi acc num :
NP_032671.2
ncbi gb acc num :
NM_008645.3
uniprot acc num :
P28665
ncbi mol weight :
27.13kD
uniprot summary :
Mug1: A proteinase activates the inhibitor by specific proteolysis in the bait region, which, by an unknown mechanism leads to reaction at the cysteinyl-glutamyl internal thiol ester site and to a conformational change, whereby the proteinase is trapped and/or covalently bound to the inhibitor. While in the tetrameric proteinase inhibitors steric inhibition is sufficiently strong, monomeric forms need a covalent linkage between the activated glutamyl residue of the original thiol ester and a terminal amino group of a lysine or another nucleophilic group on the proteinase, for inhibition to be effective. Belongs to the protease inhibitor I39 (alpha-2- macroglobulin) family. Cellular Component: extracellular region; extracellular space. Molecular Function: endopeptidase inhibitor activity; protease inhibitor activity; serine-type endopeptidase inhibitor activity. Biological Process: embryo implantation; negative regulation of peptidase activity
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
1 mg (E-Coli)
price4 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!