product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Acid-sensing ion channel 3 (Asic3)
catalog :
MBS1033681
quantity :
1 mg (E-Coli)
price :
1820 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1033681
products type :
Recombinant Protein
products full name :
Recombinant Rat Acid-sensing ion channel 3 (Asic3)
products short name :
Acid-sensing ion channel 3 (Asic3)
products name syn :
Recombinant Acid-sensing ion channel 3 (Asic3); Acid-sensing ion channel 3; ASIC3; Amiloride-sensitive cation channel 3 Dorsal root ASIC; DRASIC
other names :
acid-sensing ion channel 3; Acid-sensing ion channel 3; acid-sensing ion channel 3; DRASIC; dorsal root ASIC; acid sensing ion channel 3; proton gated cation channel DRASIC; amiloride-sensitive cation channel 3; acid-sensing (proton-gated) ion channel 3; Amiloride-sensitive cation channel 3; Dorsal root ASIC
products gene name syn :
Asic3; Accn3, Drasic
other gene names :
Asic3; Asic3; Accn3; Accn3; Drasic; ASIC3; DRASIC
uniprot entry name :
ASIC3_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
41-435
sequence length :
533
sequence :
LRRGLWATAVLLSLAAFLYQVAERVRYYGEFHHKTTLDE
RESHQLTFPAVTLCNINPLRRSRLTPNDLHWAGTALLGL
DPAEHAAYLRALGQPPAPPGFMPSPTFDMAQLYARAGHS
LEDMLLDCRYRGQPCGPENFTVIFTRMGQCYTFNSGAHG
AELLTTPKGGAGNGLEIMLDVQQEEYLPIWKDMEETPFE
VGIRVQIHSQDEPPAIDQLGFGAAPGHQTFVSCQQQQLS
FLPPPWGDCNTASLDPDDFDPEPSDPLGSPRPRPSPPYS
LIGCRLACESRYVARKCGCRMMHMPGNSPVCSPQQYKDC
ASPALDAMLRKDTCVCPNPCATTRYAKELSMVRIPSRAS
ARYLARKYNRSESYITENVLVLDIFFEALNYEAVEQKAA
YEVSE
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Rattus norvegicus (Rat)
ncbi gi num :
27465601
ncbi acc num :
NP_775158.1
ncbi gb acc num :
NM_173135.1
uniprot acc num :
O35240
ncbi mol weight :
59,227 Da
ncbi summary :
subunit that forms a proton gated Na(+) channel; may play a role in prolonged pain perception [RGD, Feb 2006]
uniprot summary :
ASIC3: Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Generates a biphasic current with a fast inactivating and a slow sustained phase. In sensory neurons is proposed to mediate the pain induced by acidosis that occurs in ischemic, damaged or inflamed tissue. May be involved in hyperalgesia. May play a role in mechanoreception. Heteromeric channel assembly seems to modulate channel properties. Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ASIC3 subfamily. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Transporter, ion channel; Transporter; Membrane protein, integral; Channel, cation; Membrane protein, multi-pass. Cellular Component: integral to plasma membrane; cytoplasm. Molecular Function: amiloride-sensitive sodium channel activity; protein binding; enterobactin transporter activity; cation channel activity; PDZ domain binding. Biological Process: detection of chemical stimulus involved in sensory perception of pain; detection of temperature stimulus involved in sensory perception; detection of chemical stimulus involved in sensory perception; sodium ion transport; sensory perception of sour taste; enterobactin transport; detection of mechanical stimulus involved in sensory perception; detection of mechanical stimulus involved in sensory perception of pain; response to mechanical stimulus; response to heat; response to acidity; detection of temperature stimulus involved in sensory perception of pain; cation transport
size1 :
1 mg (E-Coli)
price1 :
1820 USD
size2 :
1 mg (Yeast)
price2 :
2280
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!