Recombinant Human Integrin alpha-V | MyBioSource MBS1033344 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Integrin alpha-V

catalog :

MBS1033344

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1033344

products type :

Recombinant Protein

products full name :

Recombinant Human Integrin alpha-V

products short name :

Integrin alpha-V

products name syn :

Vitronectin receptor subunit alpha; CD51

other names :

integrin alpha-V isoform 2; Integrin alpha-V; integrin alpha-V; integrin subunit alpha V; Vitronectin receptor subunit alpha; CD_antigen: CD51

products gene name :

ITGAV

other gene names :

ITGAV; ITGAV; CD51; MSK8; VNRA; VTNR; MSK8; VNRA

uniprot entry name :

ITAV_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

891-1048

sequence length :

1002

sequence :

DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYV
KSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPI
EDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLL
LAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNS
ET

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Cardiovascular

products description :

The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein ses to enhance angiogenesis in Kaposi's sarcoma lesions.

products references :

Amino acid sequence of the vitronectin receptor alpha subunit and comparative expression of adhesion receptor mRNAs.Suzuki S., Argraves W.S., Arai H., Languino L.R., Pierschbacher M.D., Ruoslahti E.J. Biol. Chem. 262:14080-14085(1987) Cloning and characterisation of ITGAV, the genomic sequence for human cell adhesion protein (vitronectin) receptor alpha subunit, CD51.Sims M.A., Field S., Barnes M.R., Shaikh N., Ellington K., Murphy K.E., Spurr N.K., Campbell D.A.Cytogenet. Cell Genet. 89:268-271(2000) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)

ncbi gi num :

223468595

ncbi acc num :

NP_001138471.1

ncbi gb acc num :

NM_001144999.2

uniprot acc num :

P06756

ncbi mol weight :

19.7kD

ncbi summary :

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

uniprot summary :

ITGAV: The alpha-V integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. Belongs to the integrin alpha chain family. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion. Chromosomal Location of Human Ortholog: 2q31-q32. Cellular Component: cell surface; external side of plasma membrane; filopodium membrane; focal adhesion; integral to plasma membrane; integrin complex; membrane; microvillus membrane; phagocytic vesicle; plasma membrane. Molecular Function: extracellular matrix binding; fibronectin binding; insulin-like growth factor I binding; metal ion binding; opsonin binding; protease binding; protein binding; protein kinase C binding; transforming growth factor beta binding; viral receptor activity; voltage-gated calcium channel activity. Biological Process: angiogenesis; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of peptide antigen via MHC class I; apoptotic cell clearance; axon guidance; blood coagulation; cell adhesion; cell growth; cell migration; cell-matrix adhesion; cell-substrate adhesion; entry of symbiont into host cell by promotion of host phagocytosis; entry of virus into host cell; extracellular matrix organization and biogenesis; heterotypic cell-cell adhesion; integrin-mediated signaling pathway; leukocyte migration; negative chemotaxis; negative regulation of lipid transport; negative regulation of lipoprotein metabolic process; negative regulation of low-density lipoprotein receptor biosynthetic process; positive regulation of cell adhesion; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of osteoblast proliferation; regulation of phagocytosis; vascular endothelial growth factor receptor signaling pathway

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

0.5 mg (Yeast)

price5 :

950

more info or order :

MyBioSource product webpage