Recombinant Moloney murine leukemia virus Gag polyprotein | MyBioSource MBS1031834 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Moloney murine leukemia virus Gag polyprotein

catalog :

MBS1031834

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1031834

products type :

Recombinant Protein

products full name :

Recombinant Moloney murine leukemia virus Gag polyprotein

products short name :

Gag polyprotein

products name syn :

Core polyprotein

other names :

Pr65; Gag polyprotein; Pr65; p15 MA; pp12; p30 CA; p10 NC; Core polyprotein

products gene name :

gag

other gene names :

gag; gag; Pr65gag; MA; CA; NC-gag

uniprot entry name :

GAG_MLVMS

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

216-478, Partial.Provide the Capsid protein p30 chain.

sequence length :

478

sequence :

PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTA
LIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKA
VRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVH
YRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLER
LKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLE
RLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETE
EKEERRRTEDEQKEKERDRRRHREMSKLL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Gag polyprotein plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably link the viral protein to the host ESCRT pathway and facilitate release.

products references :

Nucleotide sequence of Moloney murine leukaemia virus.Shinnick T.M., Lerner R.A., Sutcliffe J.G.Nature 293:543-548(1981) Chappey C.Myristyl amino-terminal acylation of murine retrovirus proteins an unusual post-translational proteins modification.Henderson L.E., Krutzsch H.C., Oroszlan S.Proc. Natl. Acad. Sci. U.S.A. 80:339-343(1983) Primary structure of the low molecular weight nucleic acid-binding proteins of murine leukemia viruses.Henderson L.E., Copeland T.D., Sowder R.C., Smythers G.W., Oroszlan S.J. Biol. Chem. 256:8400-8406(1981) Phosphorylated serine residues and an arginine-rich domain of the moloney murine leukemia virus p12 protein are required for early events of viral infection.Yueh A., Goff S.P.J. Virol. 77:1820-1829(2003) Tsg101 and Alix interact with murine leukemia virus Gag and cooperate with Nedd4 ubiquitin ligases during budding.Segura-Morales C., Pescia C., Chatellard-Causse C., Sadoul R., Bertrand E., Basyuk E.J. Biol. Chem. 280:27004-27012(2005) Interaction of moloney murine leukemia virus capsid with Ubc9 and PIASy mediates SUMO-1 addition required early in infection.Yueh A., Leung J., Bhattacharyya S., Perrone L.A., de los Santos K., Pu S.-Y., Goff S.P.J. Virol. 80:342-352(2006) Characterization of the murine leukemia virus protease and its comparison with the human immunodeficiency virus type 1 protease.Feher A., Boross P., Sperka T., Miklossy G., Kadas J., Bagossi P., Oroszlan S., Weber I.T., Tozser J.J. Gen. Virol. 87:1321-1330(2006) Late domain-independent rescue of a release-deficient Moloney murine leukemia virus by the ubiquitin ligase Itch.Jadwin J.A., Rudd V., Sette P., Challa S., Bouamr F.J. Virol. 84:704-715(2010) Three-dimensional 1H NMR structure of the nucleocapsid protein NCp10 of Moloney murine leukemia virus.Demene H., Jullian N., Morellet N., de Rocquigny H., Cornille F., Maigret B., Roques B.P.J. Biomol. NMR 4:153-170(1994) Solution structures of human immunodeficiency virus type 1 (HIV-1) and moloney murine leukemia virus (MoMLV) capsid protein major-homology-region peptide analogs by NMR spectroscopy.Clish C.B., Peyton D.H., Barklis E.Eur. J. Biochem. 257:69-77(1998) Atomic resolution structure of Moloney murine leukemia virus matrix protein and its relationship to other retroviral matrix proteins.Riffel N., Harlos K., Iourin O., Rao Z., Kingsman A., Stuart D., Fry E.Structure 10:1627-1636(2002) Structural basis for packaging the dimeric genome of Moloney murine leukaemia virus.D'Souza V., Summers M.F.Nature 431:586-590(2004) Composition and sequence-dependent binding of RNA to the nucleocapsid protein of Moloney murine leukemia virus.Dey A., York D., Smalls-Mantey A., Summers M.F.Biochemistry 44:3735-3744(2005)

ncbi gi num :

9626959

ncbi acc num :

NP_057934.1

ncbi gb acc num :

NC_001501.1

uniprot acc num :

P03332

ncbi mol weight :

58kD

uniprot summary :

Mela iso3:

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

490

size3 :

0.5 mg (E-Coli)

price3 :

715

size4 :

0.05 mg (Baculovirus)

price4 :

950

size5 :

1 mg (E-Coli)

price5 :

1170

more info or order :

MyBioSource product webpage