product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant JC polyomavirus Minor capsid protein VP2
catalog :
MBS1031330
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
product information
catalog number :
MBS1031330
products type :
Recombinant Protein
products full name :
Recombinant JC polyomavirus Minor capsid protein VP2
products short name :
Minor capsid protein VP2
other names :
hypothetical protein; Minor capsid protein VP2; VP2 capsid protein; Minor structural protein VP2
products gene name :
VP2
other gene names :
Jvgp2
uniprot entry name :
VP2_POVJC
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-344
sequence length :
344
sequence :
GAALALLGDLVATVSEAAAATGFSVAEIAAGEAAATIEV
EIASLATVEGITSTSEAIAAIGLTPETYAVITGAPGAVA
GFAALVQTVTGGSAIAQLGYRFFADWDHKVSTVGLFQQP
AMALQLFNPEDYYDILFPGVNAFVNNIHYLDPRHWGPSL
FSTISQAFWNLVRDDLPALTSQEIQRRTQKLFVESLARF
LEETTWAIVNSPANLYNYISDYYSRLSPVRPSMVRQVAQ
REGTYISFGHSYTQSIDDADS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly. Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus. May participate in host cell lysis when associated with VP4. Isoform VP4 is a viroporin inducing perforation of cellular membranes to trigger virus progeny release. Forms pores of 3 nm inner diameter. VP4 is expressed about 24 hours after the late structural proteins and is not incorporated into the mature virion.
products references :
Human polyomavirus JC virus genome.Frisque R.J., Bream G.L., Cannella M.T.J. Virol. 51:458-469(1984) The Polyomaviridae Contributions of virus structure to our understanding of virus receptors and infectious entry.Neu U., Stehle T., Atwood W.J.Virology 384:389-399(2009)
ncbi gi num :
9628644
ncbi acc num :
NP_043509.1
ncbi gb acc num :
NC_001699.1
uniprot acc num :
P03095
ncbi mol weight :
53.2kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (E-Coli)
price5 :
750
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!