protein

Recombinant Human RNA-binding motif protein, Y chromosome, family 1 member A1

MBS1029535

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human RNA-binding motif protein, Y chromosome, family 1 member A1

RNA-binding motif protein, Y chromosome, family 1 member A1

RNA-binding motif protein 1; RNA-binding motif protein 2; Y chromosome RNA recognition motif 1; hRBMY

RNA-binding motif protein, Y chromosome, family 1 member A1; RNA-binding motif protein, Y chromosome, family 1 member A1; RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding motif protein, Y-linked, family 1, member A1; RNA-binding motif protein 1; RNA-binding motif protein 2; Y chromosome RNA recognition motif 1; hRBMY

RBMY1A1

RBMY1A1; RBMY1A1; RBM; RBM1; RBM2; RBMY; YRRM1; YRRM2; RBMY1C; RBM1; RBM2; YRRM1; YRRM2; hRBMY

RBY1A_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-459

496

MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLL
IKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAI
KVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRG
GTRGWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSS
RSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPP
RRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPP
SRGYAYRDNGHSNRDEHSSRG

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Epigenetics and Nuclear Signaling

RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs.

A Y chromosome gene family with RNA-binding protein homology candidates for the azoospermia factor AZF controlling human spermatogenesis.Ma K., Inglis J.D., Sharkey A., Bickmore W.A., Hill R.E., Prosser E.J., Speedson R.M., Thomson E.J., Jobling M.Cell 75:1287-1295(1993) The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.Skaletsky H., Kuroda-Kawaguchi T., Minx P.J., Cordum H.S., Hillier L.W., Brown L.G., Repping S., Pyntikova T., Ali J., Bieri T., Chinwalla A., Delehaunty A., Delehaunty K., Du H., Fewell G., Fulton L., Fulton R., Graves T.A., Hou S.-F., Latrielle P., Leonard S., Mardis E., Maupin R., McPherson J., Miner T., Nash W., Nguyen C., Ozersky P., Pepin K., Rock S., Rohlfing T., Scott K., Schultz B., Strong C., Tin-Wollam A., Yang S.-P., Waterston R.H., Wilson R.K., Rozen S., Page D.C.Nature 423:825-837(2003) Structure and organization of the RBMY genes on the human Y chromosome transposition and amplification of an ancestral autosomal hnRNPG gene.Chai N.-N., Zhou H., Hernandez J., Najmabadi H., Bhasin S., Yen P.H.Genomics 49:283-289(1998) Expression of RBM in the nuclei of human germ cells is dependent on a critical region of the Y chromosome long arm.Elliott D.J., Millar M.R., Oghene K., Ross A., Kiesewetter F., Pryor J., McIntyre M., Hargreave T.B., Saunders P.T.K., Vogt P.H., Chandley A.C., Cooke H.Proc. Natl. Acad. Sci. U.S.A. 94:3848-3853(1997) T-STAR/ETOILE a novel relative of SAM68 that interacts with an RNA-binding protein implicated in spermatogenesis.Venables J.P., Vernet C., Chew S.L., Elliott D.J., Cowmeadow R.B., Wu J., Cooke H.J., Artzt K., Eperon I.C.Hum. Mol. Genet. 8:959-969(1999) RBMY, a probable human spermatogenesis factor, and other hnRNP G proteins interact with Tra2beta and affect splicing.Venables J.P., Elliott D.J., Makarova O.V., Makarov E.M., Cooke H.J., Eperon E.C.Hum. Mol. Genet. 9:685-694(2000) hnRNP-G promotes exon 7 inclusion of survival motor neuron (SMN) via direct interaction with Htra2-beta1.Hofmann Y., Wirth B.Hum. Mol. Genet. 11:2037-2049(2002) The role of potential splicing factors including RBMY, RBMX, hnRNPG-T and STAR proteins in spermatogenesis.Elliott D.J.Int. J. Androl. 27:328-334(2004) The testis-specific human protein RBMY recognizes RNA through a novel mode of interaction.Skrisovska L., Bourgeois C.F., Stefl R., Grellscheid S.-N., Kister L., Wenter P., Elliott D.J., Stevenin J., Allain F.H.-T.EMBO Rep. 8:372-379(2007)

4826974

NP_005049.1

NM_005058.2

P0DJD3

55.4kD

This gene encodes a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. Multiple copies of this gene are found in the AZFb azoospermia factor region of chromosome Y and the encoded protein is thought to be involved in spermatogenesis. Most copies of this locus are pseudogenes, although six highly similar copies have full-length ORFs and are considered functional. Four functional copies of this gene are found within inverted repeat IR2; two functional copies of this gene are found in palindrome P3, along with two copies of PTPN13-like, Y-linked. [provided by RefSeq, Jul 2008]

RBMY1A1: RNA-binding protein involved in pre-mRNA splicing. Required for sperm development. Acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN. Binds non-specifically to mRNAs. Interacts with splicing factor proteins SFRS3/SRP20, TRA2B/SFRS10, KHDRBS1/SAM68 and KHDRBS3. Protein type: RNA splicing. Chromosomal Location of Human Ortholog: Yq11.223. Cellular Component: nucleus. Molecular Function: mRNA binding; nucleotide binding; protein binding. Biological Process: mRNA processing; regulation of alternative nuclear mRNA splicing, via spliceosome; RNA splicing. Disease: Spermatogenic Failure, Y-linked, 2

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070