product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Kallikrein 1-related peptidase b22
catalog :
MBS1024828
quantity :
0.05 mg (E-Coli)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1024828
products type :
Recombinant Protein
products full name :
Recombinant Mouse Kallikrein 1-related peptidase b22
products short name :
Kallikrein 1-related peptidase b22
products name syn :
Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP A; Glandular kallikrein K22; mGK-22; Nerve growth factor beta chain endopeptidase; Tissue kallikrein 22
other names :
kallikrein 1-related peptidase b22; Kallikrein 1-related peptidase b22; kallikrein 1-related peptidase b22; kallikrein 1-related peptidase b22; Beta-NGF-endopeptidase; Epidermal growth factor-binding protein type A; EGF-BP A; Glandular kallikrein K22; mGK-22; Nerve growth factor beta chain endopeptidase; Tissue kallikrein 22
products gene name :
Klk1b22
other gene names :
Klk1b22; Klk1b22; Klk22; Egfbp1; mGk-22; Egfbp-1; Klk-22; Klk22; EGF-BP A; mGK-22
uniprot entry name :
K1B22_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
25-259
sequence length :
259
sequence :
ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTA
AHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFN
MSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPT
TEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNE
VCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDG
VLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKN
P
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
products references :
Mouse glandular kallikrein genes identification and characterization of the genes encoding the epidermal growth factor binding proteins.Drinkwater C.C., Evans B.A., Richards R.I.Biochemistry 26:6750-6756(1987) Beta-NGF-endopeptidase structure and activity of a kallikrein encoded by the gene mGK-22.Fahnestock M., Woo J.E., Lopez G.A., Snow J., Walz D.A., Arici M.J., Mobley W.C.Biochemistry 30:3443-3450(1991) mGK-6-derived true tissue kallikrein is synthesized, processed, and targeted through a regulated secretory pathway in mouse pituitary AtT-20 cells.Peters J., Takahashi S., Tada M., Miyake Y.J. Biochem. 111:643-648(1992) Mouse glandular kallikrein genes. Structure and partial sequence analysis of the kallikrein gene locus.Evans B.A., Drinkwater C.C., Richards R.I.J. Biol. Chem. 262:8027-8034(1987)
ncbi gi num :
52693913
ncbi acc num :
NP_034244.1
ncbi gb acc num :
NM_010114.1
uniprot acc num :
P15948
ncbi mol weight :
41.77kD
ncbi pathways :
Activation Of Matrix Metalloproteinases Pathway (1323923); Degradation Of The Extracellular Matrix Pathway (1323922); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213309); Endocrine And Other Factor-regulated Calcium Reabsorption Pathway (213276); Extracellular Matrix Organization Pathway (1323909); Metabolism Of Proteins Pathway (1324154); Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway (1324217); Renin-angiotensin System Pathway (83272); Renin-angiotensin System Pathway (486)
size1 :
0.05 mg (E-Coli)
price1 :
185 USD
size2 :
0.2 mg (E-Coli)
price2 :
420
size3 :
0.5 mg (E-Coli)
price3 :
680
size4 :
1 mg (E-Coli)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!