Recombinant Mouse Angiopoietin-1 (Angpt1) | MyBioSource MBS1019907 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Angiopoietin-1 (Angpt1)

catalog :

MBS1019907

quantity :

0.05 mg (Baculovirus

price :

950 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1019907

products type :

Recombinant Protein

products full name :

Recombinant Mouse Angiopoietin-1 (Angpt1)

products short name :

Angiopoietin-1 (Angpt1)

products name syn :

Angiopoietin-1; ANG-1

other names :

angiopoietin-1 isoform 1; Angiopoietin-1; angiopoietin-1; angiopoietin 1

products gene name :

Angpt1

products gene name syn :

Angpt1; Agpt

other gene names :

Angpt1; Angpt1; Ang1; Ang-1; 1110046O21Rik; Agpt; ANG-1

uniprot entry name :

ANGP1_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

20-498; Mature full length protein

sequence length :

498

sequence :

SNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESA
TEQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWL
QKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLS
QTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEK
QLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKE
EKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLE
LMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQA
GFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHRE
DGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQ
YMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT
GTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWW
FDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLR
STTMMIRPLDF

purity :

>90%

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

other info1 :

Species: Mus musculus (Mouse)

products description :

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme (By similarity).

ncbi gi num :

46048213

ncbi acc num :

NP_033770.2

ncbi gb acc num :

NM_009640.4

uniprot acc num :

O08538

ncbi mol weight :

57kD

ncbi pathways :

Cell Surface Interactions At The Vascular Wall Pathway (1001323); HIF-1 Signaling Pathway (695223); Hemostasis Pathway (1001295); PI3K-Akt Signaling Pathway (692242); PI3K-Akt Signaling Pathway (692979); PodNet: Protein-protein Interactions In The Podocyte Pathway (755428); Rap1 Signaling Pathway (869018); Rap1 Signaling Pathway (878042); Ras Signaling Pathway (869019); Rheumatoid Arthritis Pathway (200310)

ncbi summary :

This gene encodes a secreted glycoprotein that belongs to the angiopoietin family of vascular growth factors. The encoded protein is a ligand in the vascular tyrosine kinase signaling pathway and regulates the formation and stabilization of blood vessels. This protein also functions in striated muscles by promoting proliferation, migration and differentiation of skeletal myoblasts and plays an essential role in the vascular response to tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]

uniprot summary :

ANGPT1: Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular space; microvillus; plasma membrane; extracellular region; lipid raft. Molecular Function: receptor tyrosine kinase binding; vascular endothelial growth factor receptor binding; receptor binding. Biological Process: positive regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); multicellular organismal development; positive regulation of receptor internalization; negative regulation of protein import into nucleus; negative regulation of cell adhesion; positive regulation of vascular endothelial growth factor receptor signaling pathway; negative regulation of protein amino acid phosphorylation; positive chemotaxis; ovarian follicle development; cardiac muscle morphogensis; hemopoiesis; angiogenesis; negative regulation of neuron apoptosis; cell differentiation; regulation of I-kappaB kinase/NF-kappaB cascade; vasculogenesis; protein homooligomerization; Tie receptor signaling pathway; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; positive regulation of peptidyl-serine phosphorylation; cell-substrate adhesion; negative regulation of cytokine secretion during immune response; positive regulation of phosphoinositide 3-kinase cascade; patterning of blood vessels; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; heparin biosynthetic process; positive regulation of protein ubiquitination; regulation of protein binding; negative regulation of vascular permeability; regulation of tumor necrosis factor production; regulation of satellite cell proliferation; sprouting angiogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis; endoderm development

size1 :

0.05 mg (Baculovirus)

price1 :

950 USD

size2 :

0.05 mg (Mammalian-Cell)

price2 :

1170

size3 :

0.5 mg (E-Coli)

price3 :

1265

size4 :

0.5 mg (Yeast)

price4 :

1480

size5 :

1 mg (E-Coli)

price5 :

2065

more info or order :

MyBioSource product webpage