product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Angiopoietin-1 (Angpt1)
catalog :
MBS1019907
quantity :
0.05 mg (Baculovirus
price :
950 USD
more info or order :
product information
catalog number :
MBS1019907
products type :
Recombinant Protein
products full name :
Recombinant Mouse Angiopoietin-1 (Angpt1)
products short name :
Angiopoietin-1 (Angpt1)
products name syn :
Angiopoietin-1; ANG-1
other names :
angiopoietin-1 isoform 1; Angiopoietin-1; angiopoietin-1; angiopoietin 1
products gene name :
Angpt1
products gene name syn :
Angpt1; Agpt
other gene names :
Angpt1; Angpt1; Ang1; Ang-1; 1110046O21Rik; Agpt; ANG-1
uniprot entry name :
ANGP1_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-498; Mature full length protein
sequence length :
498
sequence :
SNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESA
TEQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWL
QKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLS
QTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEK
QLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKE
EKENLQGLVSRQTFIIQELEKQLSRATNNNSILQKQQLE
LMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQA
GFNKSGIYTIYFNNMPEPKKVFCNMDVNGGGWTVIQHRE
DGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQ
YMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHT
GTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWW
FDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLR
STTMMIRPLDF
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
products description :
Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme (By similarity).
ncbi gi num :
46048213
ncbi acc num :
NP_033770.2
ncbi gb acc num :
NM_009640.4
uniprot acc num :
O08538
ncbi mol weight :
57kD
ncbi pathways :
Cell Surface Interactions At The Vascular Wall Pathway (1001323); HIF-1 Signaling Pathway (695223); Hemostasis Pathway (1001295); PI3K-Akt Signaling Pathway (692242); PI3K-Akt Signaling Pathway (692979); PodNet: Protein-protein Interactions In The Podocyte Pathway (755428); Rap1 Signaling Pathway (869018); Rap1 Signaling Pathway (878042); Ras Signaling Pathway (869019); Rheumatoid Arthritis Pathway (200310)
ncbi summary :
This gene encodes a secreted glycoprotein that belongs to the angiopoietin family of vascular growth factors. The encoded protein is a ligand in the vascular tyrosine kinase signaling pathway and regulates the formation and stabilization of blood vessels. This protein also functions in striated muscles by promoting proliferation, migration and differentiation of skeletal myoblasts and plays an essential role in the vascular response to tissue injury. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]
uniprot summary :
ANGPT1: Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. Protein type: Secreted, signal peptide; Secreted. Cellular Component: extracellular space; microvillus; plasma membrane; extracellular region; lipid raft. Molecular Function: receptor tyrosine kinase binding; vascular endothelial growth factor receptor binding; receptor binding. Biological Process: positive regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); multicellular organismal development; positive regulation of receptor internalization; negative regulation of protein import into nucleus; negative regulation of cell adhesion; positive regulation of vascular endothelial growth factor receptor signaling pathway; negative regulation of protein amino acid phosphorylation; positive chemotaxis; ovarian follicle development; cardiac muscle morphogensis; hemopoiesis; angiogenesis; negative regulation of neuron apoptosis; cell differentiation; regulation of I-kappaB kinase/NF-kappaB cascade; vasculogenesis; protein homooligomerization; Tie receptor signaling pathway; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; positive regulation of peptidyl-serine phosphorylation; cell-substrate adhesion; negative regulation of cytokine secretion during immune response; positive regulation of phosphoinositide 3-kinase cascade; patterning of blood vessels; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; heparin biosynthetic process; positive regulation of protein ubiquitination; regulation of protein binding; negative regulation of vascular permeability; regulation of tumor necrosis factor production; regulation of satellite cell proliferation; sprouting angiogenesis; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis; endoderm development
size1 :
0.05 mg (Baculovirus)
price1 :
950 USD
size2 :
0.05 mg (Mammalian-Cell)
price2 :
1170
size3 :
0.5 mg (E-Coli)
price3 :
1265
size4 :
0.5 mg (Yeast)
price4 :
1480
size5 :
1 mg (E-Coli)
price5 :
2065
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!