LGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMD
FSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGP
KDFVCQGVADAYITLVTLPKSS

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Mouse Angiopoietin-1 (Angpt1) | MBS1019907
- Recombinant Arachis hypogaea (Peanut) Allergen Ara h 1, clone P17 | MBS1019960
- Recombinant Plasmodium falciparum Apical membrane antigen 1 (AMA-1), partial
- Recombinant Antigen 85-A (fbpA) | MBS1022320
- Recombinant Vaccinia virus Complement control protein (C3L) | MBS1024068
