product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human parvovirus B19 (isolate AU) (HPV B19) Capsid protein VP2
catalog :
MBS1018772
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1018772
products type :
Recombinant Protein
products full name :
Recombinant Human parvovirus B19 (isolate AU) (HPV B19) Capsid protein VP2
products short name :
Capsid protein VP2
other names :
Capsid protein VP1; Coat protein VP1
products gene name :
VP2
uniprot entry name :
CAPSD_PAVHU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
228-781
sequence length :
781
sequence :
MTSVNSAEASTGAGGGGSNSVKSMWSEGATFSANSVTCT
FSRQFLIPYDPEHHYKVFSPAASSCHNASGKEAKVCTIS
PIMGYSTPWRYLDFNALNLFFSPLEFQHLIENYGSIAPD
ALTVTISEIAVKDVTDKTGGGVQVTDSTTGRLCMLVDHE
YKYPYVLGQGQDTLAPELPIWVYFPPQYAYLTVGDVNTQ
GISGDSKKLASEESAFYVLEHSSFQLLGTGGTASMSYKF
PPVPPENLEGCSQHFYEMYNP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Capsid protein self-assbles to form an icosahedral capsid with a T=1 symmetry, about 22 nm in diameter, and consisting of 60 copies of two size variants of the capsid proteins, VP1 and VP2, which differ by the presence of an N-terminal extension in the minor protein VP1. The capsid encapsulates the genomic ssDNA. Capsid proteins are responsible for the attachment to host cell receptors, such as the glycosphingolipid globoside or the integrin heterodimer ITGAV/ITGB1. This attachment induces virion internalization predominantly through clathrin-dependent endocytosis. Binding to the host receptors also induces capsid rearrangents leading to surface exposure of VP1 N-terminus, specifically its phospholipase A2-like region and nuclear localization signal(s). VP1 N-terminus might serve as a lipolytic enzyme to breach the endosomal membrane during entry into host cell. Intracytoplasmic transport involves microtubules and interaction between capsid proteins and host dynein. Exposure of nuclear localization signal probably allows nuclear import of capsids.
products references :
Nucleotide sequence and genome organization of human parvovirus B19 isolated from the serum of a child during aplastic crisis.Shade R.O., Blundell M.C., Cotmore S.F., Tattersall P., Astell C.R.J. Virol. 58:921-936(1986) Alpha5beta1 integrin as a cellular coreceptor for human parvovirus B19 requirement of functional activation of beta1 integrin for viral entry.Weigel-Kelley K.A., Yoder M.C., Srivastava A.Blood 102:3927-3933(2003) The globoside receptor triggers structural changes in the B19 virus capsid that facilitate virus internalization.Boensch C., Zuercher C., Lieby P., Kempf C., Ros C.J. Virol. 84:11737-11746(2010) Advances in human B19 erythrovirus biology.Servant-Delmas A., Lefrere J.J., Morinet F., Pillet S.J. Virol. 84:9658-9665(2010)
uniprot acc num :
P07299
ncbi mol weight :
64.89kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
0.5 mg (Yeast)
price5 :
950
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!