catalog number :
MBS1017422
products type :
Recombinant Protein
products full name :
Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1)
products short name :
[Heterogeneous nuclear ribonucleoproteins A2/B1 (Hnrnpa2b1)]
products name syn :
[Heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1]
other names :
[heterogeneous nuclear ribonucleoproteins A2/B1 isoform 1; Heterogeneous nuclear ribonucleoproteins A2/B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1; heterogenous nuclear ribonucleoprotein A2/B1; heterogeneous nuclear ribonucleoprotein A2/B1]
products gene name :
[Hnrnpa2b1]
products gene name syn :
[Hnrnpa2b1; Hnrpa2b1]
other gene names :
[Hnrnpa2b1; Hnrnpa2b1; Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik; Hnrpa2b1; hnRNP A2/B1]
uniprot entry name :
ROA2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-353. Full Length]
sequence :
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRN
YYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAA
MAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVG
GIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFG
FVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQE
VQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGY
GSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGG
PGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSN
YGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRS
RY
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Mus musculus (Mouse)
products description :
Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm. Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion. Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs
ncbi acc num :
NP_058086.2
ncbi gb acc num :
NM_016806.3
ncbi mol weight :
32,460 Da
ncbi pathways :
Gene Expression Pathway (971427); Processing Of Capped Intron-Containing Pre-mRNA Pathway (970809); MRNA Splicing Pathway (970580); MRNA Splicing - Major Pathway (971356); MRNA Processing Pathway (198369)
uniprot summary :
hnRNP A2/B1: Involved with pre-mRNA processing. Forms complexes (ribonucleosomes) with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Identified in the spliceosome C complex. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Interacts with IGF2BP1. 2 isoforms of the human protein are produced by alternative splicing. Protein type: RNA-binding; Spliceosome; RNA splicing. Cellular Component: spliceosome; neuron projection; membrane; cell soma; cytoplasm; perikaryon; chromatin; ribonucleoprotein complex; nucleus. Molecular Function: nucleic acid binding; single-stranded telomeric DNA binding; RNA binding; nucleotide binding. Biological Process: negative regulation of nuclear mRNA splicing, via spliceosome; RNA splicing; negative regulation of transcription from RNA polymerase II promoter; mRNA processing; RNA transport
size6 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)