product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Regenerating islet-derived protein 3-beta
catalog :
MBS1017200
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1017200
products type :
Recombinant Protein
products full name :
Recombinant Rat Regenerating islet-derived protein 3-beta
products short name :
Regenerating islet-derived protein 3-beta
products name syn :
Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta
other names :
regenerating islet-derived protein 3-beta; Regenerating islet-derived protein 3-beta; regenerating islet-derived protein 3-beta; regenerating islet-derived 3 beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta
products gene name :
Reg3b
other gene names :
Reg3b; Reg3b; Pap; Pap1; Pap; Pap1; Reg2; REG-3-beta; Reg III-beta
uniprot entry name :
REG3B_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
27-175
sequence length :
180
sequence :
EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAE
LACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWI
GLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDR
GFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S. typhimurium. May play a role in protection against infection with S. enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
products references :
Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991) PAP, a pancreatic secretory protein induced during acute pancreatitis, is expressed in rat intestine.Iovanna J.L., Keim V., Bosshard A., Orelle B., Frigerio J.-M., Dusetti N., Dagorn J.-C.Am. J. Physiol. 265:G611-G618(1993) Structural organization of the gene encoding the rat pancreatitis-associated protein. Analysis of its evolutionary history reveals an ancient divergence from the other carbohydrate-recognition domain-containing genes.Dusetti N.J., Frigerio J.-M., Keim V., Dagorn J.-C., Iovanna J.J. Biol. Chem. 268:14470-14475(1993) Sequence of a cDNA clone encoding a rat Reg-2 protein.Kamimura T., West C., Beutler E.Gene 118:299-300(1992) Molecular cloning and expression of peptide 23, a growth hormone-releasing hormone-inducible pituitary protein.Katsumata N., Chakraborty C., Myal Y., Schroedter I.C., Murphy L.J., Shiu R.P., Friesen H.G.Endocrinology 136:1332-1339(1995)
ncbi gi num :
16757982
ncbi acc num :
NP_445741.1
ncbi gb acc num :
NM_053289.1
uniprot acc num :
P25031
ncbi mol weight :
20.72kD
ncbi summary :
lectin-related secretory protein; may be involved in stress response to control bacterial proliferation during acute pancreatitis [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
890
size5 :
0.05 mg (Mammalian-Cell)
price5 :
1115
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!