catalog number :
MBS1015644
products type :
Recombinant Protein
products full name :
Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)
products short name :
[Sperm-egg fusion protein Juno (IZUMO1R)]
products name syn :
[Probable folate receptor delta; FR-delta; Folate receptor 4]
other names :
[sperm-egg fusion protein Juno; Sperm-egg fusion protein Juno; sperm-egg fusion protein Juno; FR-delta; folate receptor delta; probable folate receptor delta; folate receptor 4 (delta) homolog; folate receptor 4, delta (putative); Folate receptor 4; Folate receptor delta; FR-delta]
products gene name :
[IZUMO1R]
other gene names :
[FOLR4; FOLR4; JUNO; Folbp3; JUNO; FR-delta]
uniprot entry name :
JUNO_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[20-250. Full Length of Mature Protein]
sequence :
GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTL
TTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFY
ECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDC
EEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPF
SHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPA
QGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-PAGE
other info1 :
Species: Homo sapiens (Human)
products categories :
Developmental Biology
products description :
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate (By similarity).
ncbi acc num :
NP_001186135.1
ncbi gb acc num :
NM_001199206.1
ncbi mol weight :
27,943 Da
ncbi pathways :
Endocytosis Pathway (102279); Endocytosis Pathway (102181)
uniprot summary :
FOLR4: Belongs to the folate receptor family. 2 isoforms of the human protein are produced by alternative splicing. Chromosomal Location of Human Ortholog: 11q21. Cellular Component: plasma membrane. Molecular Function: protein binding; receptor activity; folic acid binding. Biological Process: sperm-egg recognition; fusion of sperm to egg plasma membrane; single fertilization; cell adhesion
size7 :
0.05 mg (Baculovirus)
size11 :
0.05 mg (Mammalian-Cell)
size12 :
0.1 mg (Baculovirus)
size14 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)