product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Bordetella pertussis Serotype 2 fimbrial subunit
catalog :
MBS1015373
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1015373
products type :
Recombinant Protein
products full name :
Recombinant Bordetella pertussis Serotype 2 fimbrial subunit
products short name :
Serotype 2 fimbrial subunit
other names :
serotype 2 fimbrial subunit; Serotype 2 fimbrial subunit; serotype 2 fimbrial subunit
products gene name :
fim2
other gene names :
fim2; fim2
uniprot entry name :
FM2_BORPE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
27-207
sequence length :
210
sequence :
DDGTIVITGTITDTTCVIEDPSGPNHTKVVQLPKISKNA
LKANGDQAGRTPFIIKLKDCPSSLGNGVKAYFEPGPTTD
YSTGDLRAYKMVYATNPQTQLSNITAATEAQGVQVRISN
LNDSKITMGANEATQQAAGFDPEVQTGGTSRTVTMRYLA
SYVKKNGDVEASAITTYVGFSVVYP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B. pertussis are prime candidates for being involved in this process.
products references :
Cloning and nucleotide sequence analysis of the serotype 2 fimbrial subunit gene of Bordetella pertussis.Livey I., Duggleby C.J., Robinson A.Mol. Microbiol. 1:203-209(1987) Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003)
ncbi gi num :
33592254
ncbi acc num :
NP_879898.1
ncbi gb acc num :
NC_002929.2
uniprot acc num :
P05788
ncbi mol weight :
23.3kD
ncbi pathways :
Pertussis Pathway (218102); Pertussis Pathway (218099)
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!