GCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSC
CLIPQTGSHRLRLYEREDHKGLMMELSEDCPSIQDRFHL
SEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDW
GAMDAKAGSLRRVVDLY

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human G antigen family C member 1 (PAGE4) | MBS1015244
- Recombinant eosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGS ...
- Recombinant Enterobacteria phage T4 (Bacteriophage T4) Recombination protein uvs ...
- Recombinant Pesticidal crystal protein cry1Fb | MBS1016624
- Recombinant Apis mellifera (Honeybee) Venom serine carboxypeptidase | MBS1016663
