Recombinant Human Progonadoliberin-2 | MyBioSource MBS1014236 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Progonadoliberin-2

catalog :

MBS1014236

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS1014236

products type :

Recombinant Protein

products full name :

Recombinant Human Progonadoliberin-2

products short name :

Progonadoliberin-2

products name syn :

Progonadoliberin II

other names :

progonadoliberin-2 isoform a preproprotein; Progonadoliberin-2; progonadoliberin-2; gonadotropin releasing hormone 2; Progonadoliberin II

products gene name :

GNRH2

other gene names :

GNRH2; GNRH2; GnRH-II; LH-RHII; GnRH II; LH-RH II

uniprot entry name :

GON2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

24-120

sequence length :

120

sequence :

QHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSP
VQTAHGLPSDALAPLDDSMPWEGRTTAQWSLHRKRHLAR
TLLTAAREPRPAPPSSNKV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Signal Transduction

products description :

Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.

products references :

Second gene for gonadotropin-releasing hormone in humans.White R.B., Eisen J.A., Kasten T.L., Fernald R.D.Proc. Natl. Acad. Sci. U.S.A. 95:305-309(1998) The DNA sequence and comparative analysis of human chromosome 20.Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.Nature 414:865-871(2001)

ncbi gi num :

872724315

ncbi acc num :

NP_001297149.1

ncbi gb acc num :

NM_001310220.1

uniprot acc num :

O43555

ncbi mol weight :

26.5kD

ncbi pathways :

Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1269592); GnRH Signaling Pathway (83091); GnRH Signaling Pathway (502); Hormone Ligand-binding Receptors Pathway (1269559); Signal Transduction Pathway (1269379); Signaling By GPCR Pathway (1269543)

ncbi summary :

This gene encodes a secreted peptide hormone and member of the gonadotropin-releasing hormone (GnRH) family of proteins. The encoded protein regulates reproductive function by stimulating the production and release of the gonadotropins follicle-stimulating hormone (FSH) and luteinizing hormone (LH). The encoded protein may inhibit endometrial, ovarian, prostate, and breast cancer cell proliferation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

uniprot summary :

GNRH2: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones. Belongs to the GnRH family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 20p13. Cellular Component: extracellular region. Molecular Function: hormone activity. Biological Process: multicellular organismal development; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

830

size5 :

0.05 mg (Mammalian-Cell)

price5 :

1055

more info or order :

MyBioSource product webpage