product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1)
catalog :
MBS1012120
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
image
image 1 :
MyBioSource MBS1012120 image 1
product information
catalog number :
MBS1012120
products type :
Recombinant Protein
products full name :
Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1)
products short name :
[Nucleoside diphosphate kinase (YNK1)]
other names :
[nucleoside diphosphate kinase; Nucleoside diphosphate kinase; nucleoside diphosphate kinase]
products gene name :
[YNK1]
other gene names :
[YNK1; YNK1; NDK1; NDK1; YNK; NDK; NDP kinase]
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-153. Full Length]
sequence :
MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAI
KLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATV
WEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNV
CHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE
purity :
Greater than 85% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
image1 heading :
SDS-Page
other info1 :
Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
other info2 :
Storage Buffer: Tris-based buffer, 50% glycerol. Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.
products references :
Sequence of a 20.7 kb region of yeast chromosome XI includes the NUP100 gene, an open reading frame (ORF) possibly representing a nucleoside diphosphate kinase gene, tRNAs for His, Val and Trp in addition to seven ORFs with weak or no significant similarity to known proteins." Rasmussen S.W. Yeast 10:S69-S74(1994)
ncbi gi num :
6322783
ncbi acc num :
NP_012856.1
ncbi gb acc num :
NM_001179633.1
uniprot acc num :
P36010
ncbi mol weight :
37.2 kDa
ncbi pathways :
Adenine Ribonucleotide Biosynthesis, IMP = ADP,ATP Pathway (620139); Adenine Ribonucleotide Biosynthesis, IMP = ADP,ATP Pathway (468242); Biosynthesis Of Secondary Metabolites Pathway (148673); De Novo Biosyn. Of Pyrimidine Deoxyribonucleotides Pathway (198739); De Novo Biosynthesis Of Purine Nucleotides Pathway (198707); De Novo Biosynthesis Of Pyrimidine Ribonucleotides Pathway (198664); Guanine Ribonucleotide Biosynthesis IMP = GDP,GTP Pathway (620140); Guanine Ribonucleotide Biosynthesis IMP = GDP,GTP Pathway (468243); Metabolic Pathways (131993); Metabolism Pathway (1011215)
uniprot summary :
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Required for repair of UV radiation- and etoposide-induced DNA damage.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.01 mg (Yeast)
price2 :
260
size3 :
0.05 mg (E-Coli)
price3 :
320
size4 :
0.05 mg (Yeast)
price4 :
360
size5 :
0.1 mg (E-Coli)
price5 :
535
size6 :
0.1 mg (Yeast)
price6 :
595
size7 :
0.2 mg (E-Coli)
price7 :
855
size8 :
0.05 mg (Baculovirus)
price8 :
925
size9 :
0.2 mg (Yeast)
price9 :
965
size10 :
0.5 mg (E-Coli)
price10 :
1125
size11 :
0.05 mg (Mammalian-Cell)
price11 :
1160
size12 :
0.1 mg (Baculovirus)
price12 :
1330
size13 :
0.5 mg (Yeast)
price13 :
1345
size14 :
1 mg (E-Coli)
price14 :
1725
size15 :
0.5 mg (Baculovirus)
price15 :
1745
size16 :
0.1 mg (Mammalian-Cell)
price16 :
1900
size17 :
1 mg (Yeast)
price17 :
2065
size18 :
1 mg (Baculovirus)
price18 :
2715
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!