product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D) Protein X
catalog :
MBS1009704
quantity :
0.01 mg (E-Coli)
price :
145 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1009704
products type :
Recombinant Protein
products full name :
Recombinant Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D) Protein X
products short name :
Hepatitis B virus genotype D subtype ayw
products name syn :
HBx; Peptide X; pX
other names :
Protein X; Protein X; HBx; Peptide X; pX
products gene name :
X
other gene names :
X
uniprot entry name :
X_HBVD3
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-154
sequence length :
154
sequence :
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSS
PSPSAVPTDHGAHLSLRGLPVCAFSSAGPCALRFTSARR
METTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLF
KDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)
products description :
Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1.
products references :
Nucleotide sequence of the hepatitis B virus genome (subtype ayw) cloned in E. coli." Galibert F., Mandart E., Fitoussi F., Tiollais P., Charnay P. Nature 281:646-650(1979)
ncbi gi num :
139896
ncbi acc num :
P03165.2
uniprot acc num :
P03165
ncbi mol weight :
16,618 Da
size1 :
0.01 mg (E-Coli)
price1 :
145 USD
size2 :
0.05 mg (E-Coli)
price2 :
205
size3 :
0.2 mg (E-Coli)
price3 :
520
size4 :
0.5 mg (E-Coli)
price4 :
850
size5 :
0.05 mg (Baculovirus)
price5 :
895
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!