product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 18 Minor capsid protein L2
catalog :
MBS1007212
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1007212
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 18 Minor capsid protein L2
products short name :
papillomavirus type 18 Minor capsid protein L2
other names :
Minor capsid protein L2; L2 protein
products gene name :
L2
other gene names :
L2; L2
uniprot entry name :
VL2_HPV18
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-462
sequence length :
462
sequence :
MVSHRAARRKRASVTDLYKTCKQSGTCPPDVVPKVEGTT
LADKILQWSSLGIFLGGLGIGTGSGTGGRTGYIPLGGRS
NTVVDVGPTRPPVVIEPVGPTDPSIVTLIEDSSVVTSGA
PRPTFTGTSGFDITSAGTTTPAVLDITPSSTSVSISTTN
FTNPAFSDPSIIEVPQTGEVAGNVFVGTPTSGTHGYEEI
PLQTFASSGTGEEPISSTPLPTVRRVAGPRLYSRAYQQV
SVANPEFLTRPSSLITYDNPA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, escorts the genomic DNA into the nucleus, in particular by promoting virion endosomal escape. It is involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.
products references :
Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products.Cole S.T., Danos O.J. Mol. Biol. 193:599-608(1987)
ncbi acc num :
NP_040316.1
uniprot acc num :
P06793
ncbi mol weight :
65.6kD
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.05 mg (Yeast)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.2 mg (Yeast)
price4 :
460
size5 :
0.5 mg (Yeast)
price5 :
750
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!