catalog number :
MBS1006358
products type :
Recombinant Protein
products full name :
Recombinant Clostridium pasteurianum Rubredoxin
products short name :
[Rubredoxin]
other names :
[Rubredoxin; Rubredoxin]
products gene name :
[Rd]
other gene names :
[Rd; Rd]
uniprot entry name :
RUBR_CLOPA
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-54. Full Length]
sequence :
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVC
PLCGVGKDQFEEVEE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-Page
other info1 :
Species: Clostridium pasteurianum
other info2 :
Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products description :
Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.
products references :
Cloning, sequencing and expression in Escherichia coli of the rubredoxin gene from Clostridium pasteurianum." Mathieu I., Meyer J., Moulis J.-M. Biochem. J. 285:255-262(1992)
ncbi mol weight :
22.04kD
uniprot summary :
Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.
size5 :
0.05 mg (Baculovirus)
size9 :
0.05 mg (Mammalian-Cell)
size11 :
0.1 mg (Baculovirus)
size13 :
0.5 mg (Baculovirus)
size15 :
0.1 mg (Mammalian-Cell)
size16 :
1 mg (Baculovirus)