catalog number :
MBS1006202
products type :
Recombinant Protein
products full name :
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
products short name :
[Invasin ipaB (ipaB)]
products name syn :
[Recombinant Invasin ipaB (ipaB); Invasin ipaB; 62 kDa antigen]
other names :
[invasion protein; Invasin IpaB; invasion protein; 62 kDa antigen]
products gene name syn :
[ipaB]
other gene names :
[ipaB; ipaB; S0136]
uniprot entry name :
IPAB_SHIFL
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-312. Partial]
sequence :
MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFS
LTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQ
LTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNL
EFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLEN
KINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKD
RTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAE
QLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLA
LFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGK
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Shigella flexneri
ncbi acc num :
NP_085290.1
ncbi gb acc num :
NC_002698.1
ncbi mol weight :
62,201 Da
uniprot summary :
Function: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. Forms a pore with IpaC, which is inserted into the host cell membrane through the Mxi/Spa apparatus, during cell contact. This pore probably allows the translocation of IpaA. IpaB has also been found to be necessary and sufficient to activate macrophage apoptosis by binding to interleukin-1 beta converting enzyme (ICE). Has also been shown to be important, along with IpaD, to block or regulate secretion through the Mxi/Spa translocon in the presence or absence of the secretion signal, respectively. Through interaction with host human MAD2L2, constitutively activates the anaphase-promoting complex APC and induces a cell cycle arrest to prevent epithelial renewal in order to promote bacterial colonization. Ref.7 Ref.9. Subunit structure: Interacts with host human MAD2L2; in the G2/M phase of the cell cycle. Ref.9. Subcellular location: Secreted. Host cell membrane; Multi-pass membrane protein . Potential. Host nucleus . Probable. Note: Secreted through the specialized type-III secretion system Mxi/Spa. Inserted into the host cell membrane. Also secreted into the host cell cytoplasm after the escape of bacteria from phagosome, where it colocalizes with ICE. May localize to host cell nucleus during G2/M phase of the host cell cycle. Ref.9. Induction: Synthesis of this immunogen is repressed at 30 degrees Celsius and restored at 37 degrees Celsius. Sequence similarities: Belongs to the invasin protein B family.
size4 :
0.05 mg (Baculovirus)
size8 :
0.05 mg (Mammalian-Cell)
size9 :
0.1 mg (Baculovirus)
size11 :
0.5 mg (Baculovirus)
size13 :
0.1 mg (Mammalian-Cell)
size14 :
1 mg (Baculovirus)