catalog number :
MBS1005806
products type :
Recombinant Protein
products full name :
Recombinant Rabies virus Glycoprotein G (G)
products short name :
Glycoprotein G (G)
products name syn :
Recombinant Glycoprotein G (G); Glycoprotein G
other names :
transmembrane glycoprotein G; Glycoprotein G; transmembrane glycoprotein G
other gene names :
RABVgp4; G
uniprot entry name :
VGLG_RABVP
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-459
sequence :
KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLS
GFSYMELKVGYISAIKMNGFTCTGVVTEAETYTNFVGYV
TTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYP
DYHWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPG
GNCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNS
RGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLR
LMDGTWVAMQTSNETKWCPPGQLVNLHDFRSDEIEHLVV
EELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFG
KAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLRVGGRC
HPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLVS
SVIPLMHPLADPSTVFKNGDEAEDFVEVHLPDVHERISG
VDLGLPNWGKY
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Species: Rabies virus (strain Pasteur vaccins / PV) (RABV)
products description :
Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein G and thereby facilitate rabies virus entry into cells .
ncbi acc num :
NP_056796.1
ncbi gb acc num :
NC_001542.1
uniprot summary :
Function: Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein G and thereby facilitate rabies virus entry into cells . By similarity. Subunit structure: Homotrimer. Interacts with matrix protein . By similarity. Subcellular location: Virion membrane; Single-pass type I membrane protein . Potential. Post-translational modification: Glycosylated and palmitoylated by host. Glycosylation is crucial for glycoprotein export at the cell surface . By similarity. Biotechnological use: Primary surface antigen capable of inducing and reacting with virus-neutralizing antibodies. Almost all human and veterinary vaccines are based on the functional aspects of the G protein. Miscellaneous: Arg-352 is highly involved in rabies virus pathogenicity. Its mutation dramatically attenuates the virus . By similarity. Sequence similarities: Belongs to the lyssavirus glycoprotein family.