product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237
catalog :
MBS1004762
quantity :
0.01 mg (E-Coli)
price :
235 USD
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS1004762 image 1
product information
catalog number :
MBS1004762
products type :
Recombinant Protein
products full name :
Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237
products short name :
[Glutenin, high molecular weight subunit PC237]
products name syn :
[Recombinant Glutenin, high molecular weight subunit PC237; Glutenin, high molecular weight subunit PC237]
other names :
[Glutenin, high molecular weight subunit PC237; Glutenin, high molecular weight subunit PC237]
uniprot entry name :
GLT2_WHEAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[1-37aa; Full Length]
sequence length :
39
sequence :
LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSA
purity :
>=90%(SDS-PAGE)
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes?Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
image1 heading :
SDS-PAGE
other info1 :
Species: Triticum aestivum (Wheat)
products description :
Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.
ncbi gi num :
121451
ncbi acc num :
P02862.1
uniprot acc num :
P02862
ncbi mol weight :
30kD
ncbi pathways :
Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)
uniprot summary :
Function: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough. Subunit structure: Disulfide-bridge linked aggregates. Miscellaneous: Glutenins are coded by several genes on each of the group 1 chromosomes of wheat. Sequence similarities: Belongs to the gliadin/glutenin family.
size1 :
0.01 mg (E-Coli)
price1 :
235 USD
size2 :
0.05 mg (E-Coli)
price2 :
320
size3 :
0.1 mg (E-Coli)
price3 :
535
size4 :
0.2 mg (E-Coli)
price4 :
855
size5 :
0.5 mg (E-Coli)
price5 :
1125
size6 :
1 mg (E-Coli)
price6 :
1725
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!