product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Interferon alpha/beta receptor 2
catalog :
MBS1004138
quantity :
0.05 mg (E-Coli)
price :
190 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1004138
products type :
Recombinant Protein
products full name :
Recombinant Mouse Interferon alpha/beta receptor 2
products short name :
Interferon alpha/beta receptor 2
products name syn :
Type I interferon receptor 2
other names :
interferon alpha/beta receptor 2 isoform b; Interferon alpha/beta receptor 2; interferon alpha/beta receptor 2; interferon (alpha and beta) receptor 2; Type I interferon receptor 2
products gene name :
Ifnar2
other gene names :
Ifnar2; Ifnar2; Ifnar-2; AI747302; IFN-R-2; IFN-alpha/beta receptor 2
uniprot entry name :
INAR2_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
22-242
sequence length :
248
sequence :
SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKS
GPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKW
LEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPE
FEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQI
GDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFD
DDPAIKSPLKCIVLQPGQESGLSESA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 2 and 3 may be potent inhibitors of type I IFN receptor activity.
products references :
Mammalian type I interferon receptors consists of two subunits IFNaR1 and IFNaR2.Kim S.H., Cohen B., Novick D., Rubinstein M.Gene 196:279-286(1997) Cloning and characterization of soluble and transmembrane isoforms of a novel component of the murine type I interferon receptor, IFNAR 2.Owczarek C.M., Hwang S.Y., Holland K.A., Gulluyan L.M., Tavaria M., Weaver B., Reich N.C., Kola I., Hertzog P.J.J. Biol. Chem. 272:23865-23870(1997) Multiple regions within the promoter of the murine Ifnar-2 gene confer basal and inducible expression.Hardy M.P., Hertzog P.J., Owczarek C.M.Biochem. J. 365:355-367(2002) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006) The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)
ncbi gi num :
160358795
ncbi acc num :
NP_001103968.1
ncbi gb acc num :
NM_001110498.1
uniprot acc num :
O35664
ncbi mol weight :
26.76kD
ncbi pathways :
Cytokine Signaling In Immune System Pathway (1323763); Cytokine-cytokine Receptor Interaction Pathway (83248); Cytokine-cytokine Receptor Interaction Pathway (460); Hepatitis C Pathway (173974); Hepatitis C Pathway (173907); Herpes Simplex Infection Pathway (377874); Herpes Simplex Infection Pathway (377865); Immune System Pathway (1323639); Influenza A Pathway (217174); Influenza A Pathway (217150)
uniprot summary :
IFNAR2: Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity. Belongs to the type II cytokine receptor family. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Receptor, cytokine; Membrane protein, integral. Cellular Component: extracellular region; extracellular space; integral to membrane; integral to plasma membrane; membrane; plasma membrane. Molecular Function: interferon-alpha/beta binding; interferon-alpha/beta receptor activity; interleukin-20 binding; protein kinase binding. Biological Process: cell proliferation; regulation of transcription from RNA polymerase II promoter
size1 :
0.05 mg (E-Coli)
price1 :
190 USD
size2 :
0.2 mg (E-Coli)
price2 :
460
size3 :
0.5 mg (E-Coli)
price3 :
750
size4 :
0.05 mg (Baculovirus)
price4 :
975
size5 :
1 mg (E-Coli)
price5 :
1180
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!