Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesion (fimH) | MyBioSource MBS1004050 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesion (fimH)

catalog :

MBS1004050

quantity :

0.01 mg (E-Coli)

price :

235 USD

more info or order :

MyBioSource product webpage

image

image 1 :

product information

catalog number :

MBS1004050

products type :

Recombinant Protein

products full name :

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesion (fimH)

products short name :

[fimbrin D-mannose specific adhesion (fimH)]

other names :

[minor component of type 1 fimbriae; Protein FimH; minor component of type 1 fimbriae]

products gene name :

[fimH]

other gene names :

[fimH; fimH; ECK4311; JW4283]

uniprot entry name :

FIMH_ECOLI

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

[22-300. Full Length of Mature Protein]

sequence :

FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYS
GSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGG
VAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVV
PTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGY
YLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPA
NNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIG
VTFVYQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

image1 heading :

SDS-Page

other info2 :

Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

products description :

Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.

products references :

Three fim genes required for the regulation of length and mediation of adhesion of Escherichia coli type 1 fimbriae.Klemm P., Christiansen G.Mol. Gen. Genet. 208:439-445(1987) FimH family of type 1 fimbrial adhesins functional heterogeneity due to minor sequence variations among fimH genes.Sokurenko E.V., Courtney H.S., Ohman D.E., Klemm P., Hasty D.L.J. Bacteriol. 176:748-755(1994) Analysis of the Escherichia coli genome VI DNA sequence of the region from 92.8 through 100 minutes.Burland V.D., Plunkett G. III, Sofia H.J., Daniels D.L., Blattner F.R.Nucleic Acids Res. 23:2105-2119(1995) The complete genome sequence of Escherichia coli K-12.Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y.Science 277:1453-1462(1997) Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) Purification of the Escherichia coli type 1 pilin and minor pilus proteins and partial characterization of the adhesin protein.Hanson M.S., Hempel J., Brinton C.C. Jr.J. Bacteriol. 170:3350-3358(1988) Direct evidence that the FimH protein is the mannose-specific adhesin of Escherichia coli type 1 fimbriae.Krogfelt K.A., Bergmans H., Klemm P.Infect. Immun. 58:1995-1998(1990) Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Auguste C.G., Strouse R., Langermann S., Waksman G., Hultgren S.J.Mol. Microbiol. 44:903-915(2002)

ncbi gi num :

16132141

ncbi acc num :

NP_418740.1

ncbi gb acc num :

NC_000913.3

uniprot acc num :

P08191

ncbi mol weight :

56.5kD

ncbi summary :

Mutants of FimH have been isolated that auto-aggregate. [More information is available at EcoGene: EG10315]. Type 1, or mannose-sensitive, fimbriae in Escherichia coli mediate binding to receptor structures allowing the bacteria to colonize various host tissues. [More information is available at EcoCyc: EG10315].

uniprot summary :

size1 :

0.01 mg (E-Coli)

price1 :

235 USD

size2 :

0.01 mg (Yeast)

price2 :

260

size3 :

0.05 mg (E-Coli)

price3 :

320

size4 :

0.05 mg (Yeast)

price4 :

360

size5 :

0.1 mg (E-Coli)

price5 :

535

size6 :

0.1 mg (Yeast)

price6 :

595

size7 :

0.2 mg (E-Coli)

price7 :

855

size8 :

0.2 mg (Yeast)

price8 :

965

size9 :

0.05 mg (Baculovirus)

price9 :

1025

size10 :

0.5 mg (E-Coli)

price10 :

1125

size11 :

0.05 mg (Mammalian-Cell)

price11 :

1270

size12 :

0.5 mg (Yeast)

price12 :

1345

size13 :

0.1 mg (Baculovirus)

price13 :

1485

size14 :

1 mg (E-Coli)

price14 :

1725

size15 :

0.5 mg (Baculovirus)

price15 :

1935

size16 :

0.1 mg (Mammalian-Cell)

price16 :

2065

size17 :

1 mg (Yeast)

price17 :

2065

size18 :

1 mg (Baculovirus)

price18 :

3005

more info or order :

MyBioSource product webpage