product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Pro-interleukin-16 (IL16)
catalog :
MBS1003331
quantity :
1 mg (E-Coli)
price :
1195 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS1003331
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Pro-interleukin-16 (IL16)
products short name :
(Rhesus macaque) Pro-interleukin-16 (IL16)
products name syn :
Recombinant (Rhesus macaque) Pro-interleukin-16 (IL16); Pro-interleukin-16 Cleaved into the following chain: 1. Interleukin-16; 2. IL-16; Lymphocyte chemoattractant factor; LCF
other names :
pro-interleukin-16; Pro-interleukin-16; pro-interleukin-16; IL-16; interleukin 16 (lymphocyte chemoattractant factor); Lymphocyte chemoattractant factor
products gene name syn :
IL16
other gene names :
IL16; IL16; IL-16; IL-16; LCF
uniprot entry name :
IL16_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
510-630
sequence length :
630
sequence :
SAASASAASDVSVESSAEATVYTVTLEKMSAGLGFSLEG
GKGSLHGDKPLTINRIFKGAASEQSETIQPGDEILQLAG
TAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQPKETTA
AADS
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
74136177
ncbi acc num :
NP_001027980.1
ncbi gb acc num :
NM_001032808.1
uniprot acc num :
O62675
ncbi mol weight :
66,563 Da
uniprot summary :
Function: Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4 . By similarity.Pro-interleukin-16 is involved in cell cycle progression in T-cells. Appears to be involved in transcriptional regulation of SKP2 and is probably part of a transcriptional repression complex on the core promoter of the SKP2 gene. May act as a scaffold for GABPB1 (the DNA-binding subunit the GABP transcription factor complex) and HDAC3 thus maintaining transcriptional repression and blocking cell cycle progression in resting T-cells . By similarity. Subunit structure: Homotetramer . Probable. Pro-interleukin-16 interacts (via PDZ 2 domain) with PPP1R12A, PPP1R12B and PPP1R12C. Pro-interleukin-16 interacts with GRIN2A. Pro-interleukin-16 interacts with GABPB1. Pro-interleukin-16 interacts (via PDZ 3 domain) with HDAC3 . By similarity. Subcellular location: Interleukin-16: Secreted . By similarity. Pro-interleukin-16: Cytoplasm. Nucleus . By similarity. Sequence similarities: Contains 2 PDZ (DHR) domains.
size1 :
1 mg (E-Coli)
price1 :
1195 USD
size2 :
1 mg (Yeast)
price2 :
1650
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!