catalog number :
MBS1000327
products type :
Recombinant Protein
products full name :
Recombinant Mouse Desmoglein-3 (Dsg3), partial
products short name :
[Desmoglein-3 (Dsg3)]
products name syn :
[130 kDa pemphigus vulgaris antigen homolog]
other names :
[Desmoglein-3; Desmoglein-3; desmoglein-3; desmoglein 3; 130 kDa pemphigus vulgaris antigen homolog]
products gene name :
[Dsg3]
other gene names :
[Dsg3; Dsg3; bal]
uniprot entry name :
DSG3_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
[50-617. Partial]
sequence :
EWVKFAKPCREREDNSRRNPIAKITSDFQKNQKITYRIS
GVGIDQPPFGIFVVDPNNGDINITAIVDREETPSFLITC
RALNALGQDVERPLILTVKILDVNDNPPIFSQTIFKGEI
EENSASNSLVMILNATDADEPNHMNSKIAFKIVSQEPAG
MSMFLISRNTGEVRTLTSSLDREQISSYHLVVSGADNDG
TGLSTQCECSIKIKDVNDNFPVLRESQYSARIEENTLNA
ELLRFQVTDWDEEYTDNWLAVYFFTSGNEGNWFEIETDP
RTNEGILKVVKALDYEQVQSMQFSIAVRNKAEFHQSVIS
QYRVQSTPVTIQVIDVREGISFRPPSKTFTVQRGVSTNK
LVGYILGTYQATDEDTGKAASSVRYVLGRNDGGLLVIDS
KTAQIKFVKNIDRDSTFIVNKTISAEVLAIDENTGKTST
GTIYVEVPSFNENCPSVVLEKKDICTSSPSVTLSVRTLD
RGKYTGPYTVSLEEQPLKLPVMWTITTLNATSALLQAQQ
QVSPGVYNVPVIVKDNQDGLCDTPESLTLTVCQCDDRSM
CRAPIPSREPNTYGESSWRLGP
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
image1 heading :
SDS-PAGE
other info2 :
Species: Mus musculus (Mouse). Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.
products categories :
Signal Transduction
products description :
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
products references :
cDNA cloning and chromosomal assignment of the mouse gene for desmoglein 3 (Dsg3), the pemphigus vulgaris antigen." Ishikawa H., Silos S.A., Tamai K., Copeland N.G., Gilbert D.J., Jenkins N.A., Uitto J. Mamm. Genome 5:803-804(1994)
ncbi mol weight :
79.18kD
ncbi pathways :
Apoptosis Pathway (1323524); Apoptotic Cleavage Of Cell Adhesion Proteins Pathway (1323551); Apoptotic Cleavage Of Cellular Proteins Pathway (1323549); Apoptotic Execution Phase Pathway (1323548); Programmed Cell Death Pathway (1323523)
ncbi summary :
This gene encodes a member of the cadherin family of proteins that forms an integral transmembrane component of desmosomes, the multiprotein complexes involved in cell adhesion, organization of the cytoskeleton, cell sorting and cell signaling. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional protein. Mice lacking the encoded protein exhibit loss of keratinocyte cell adhesion resulting in a phenotype that resembles that of patients with pemphigus vulgaris. This gene is located in a cluster of desmosomal cadherin genes on chromosome 18. [provided by RefSeq, Feb 2016]
uniprot summary :
DSG3: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Protein type: Membrane protein, integral; Cell adhesion. Cellular Component: cell junction; desmosome; integral to membrane; integral to plasma membrane; membrane; plasma membrane; spot adherens junction. Molecular Function: calcium ion binding; metal ion binding. Biological Process: cell adhesion; homophilic cell adhesion
size3 :
0.01 mg (Baculovirus)
size6 :
0.02 mg (Baculovirus)
size10 :
0.05 mg (Baculovirus)
size12 :
0.1 mg (Baculovirus)
size15 :
0.5 mg (Baculovirus)
size16 :
0.05 mg (Mammalian-Cell)
size18 :
1 mg (Baculovirus)
size20 :
0.1 mg (Mammalian-Cell)