FFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKS
KNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELF
EQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINY
AYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVIND
SYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYF
PETTE

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Major capsid protein L1 (L1), partial | MBS1000761
- Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Enve ...
- Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Thymidylate k ...
- Recombinant Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/19 ...
- Recombinant 14 kDa antigen (hspX) | MBS1011120
