VVKDRTKGDALDLEDAQAFTAPKKIYSGEYSDCKDADLV
VITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDG
IFLVAANPVDILTYATWKFSGFPKDRVIGSGTSLDSSRL
RVALGKQFNVDPRSVDAYIMGEHGDSEFAAYSTATIGTR
PVRDVAKEQGVSDEDLAKLEDGVRNKAYDIINLKGATFY
GIGTALMRISKAILRDENAVL

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE) | MBS1000434
- Recombinant Human papillomavirus type 18 Protein E7 | MBS1000515
- Recombinant Human Bile salt-activated lipase (CEL) | MBS1000851
- Recombinant Microbacterium testaceum (strain StLB037) N-acyl homoserine lactonas ...
- Recombinant Epstein-Barr virus DNA polymerase processivity factor BMRF1 (BMRF1)