This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Monoclonal Anti-DYRK3 antibody produced in mouse
catalog :
WH0008444M1
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E10
reactivity :
human
application :
immunohistochemistry
citations: 1
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry; human; 1:200; fig 2, 3
Nordentoft I, Lamy P, Birkenkamp Demtroder K, Shumansky K, Vang S, Hornshøj H, et al. Mutational context and diverse clonal development in early and late bladder cancer. Cell Rep. 2014;7:1649-1663 pubmed publisher
product information
cat no :
WH0008444M1
brand :
SIGMA
name :
Monoclonal Anti-DYRK3 antibody produced in mouse
prod type :
Chemical
name suffix :
clone 3E10, purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
syns :
Anti-DYRK5; Anti-RED; Anti-REDK; Anti-dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
indirect ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
species reactivity :
human
immunogen :
DYRK3 (AAH15501, a.a. 1-569) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
clone :
3E10
immunogen sequence :
(without GST)
MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPP
RRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSN
TIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPK
VVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAK
KRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKII
GKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEI
RILEHLKKQDKTGSMNVIHML
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information
MilliporeSigma
PO Box 14508
St. Louis, MO 63178
https://www.sigmaaldrich.com
1-800-325-3010
headquarters: USA