This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Monoclonal Anti-WRB antibody produced in mouse
catalog :
WH0007485M4
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A3
reactivity :
human, mouse, rat
application :
western blot
product information
cat no :
WH0007485M4
brand :
SIGMA
name :
Monoclonal Anti-WRB antibody produced in mouse
prod type :
Chemical
name suffix :
clone 2A3, purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
syns :
Anti-CHD5; Anti-tryptophan rich basic protein
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
western blot: suitable; indirect ELISA: suitable
species reactivity :
human, mouse, rat
immunogen :
WRB (NP_004618, a.a. 29-102) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
clone :
2A3
immunogen sequence :
(without GST)
PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMD
EFARYARLERKINKMTDKLKTHVKARTAQLAKIK*
PSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMD
EFARYARLERKINKMTDKLKTHVKARTAQLAKIK*
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information

MilliporeSigma
questions and comments
