This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Monoclonal Anti-F3 antibody produced in mouse
catalog :
WH0002152M1
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4G4
reactivity :
human
application :
western blot, immunocytochemistry
citations: 1
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
|
product information
cat no :
WH0002152M1
brand :
SIGMA
name :
Monoclonal Anti-F3 antibody produced in mouse
prod type :
Chemical
name suffix :
clone 4G4, purified immunoglobulin, buffered aqueous solution
storage :
-20C
storage temp :
-20C
physical form :
Solution in phosphate buffered saline, pH 7.2
shipped in :
dry ice
syns :
Anti-CD142; Anti-TF; Anti-TFA; Anti-coagulation factor III (thromboplastin, tissue factor)
form :
buffered aqueous solution
antibody form :
purified immunoglobulin
application(s) :
indirect ELISA: suitable; western blot: suitable
species reactivity :
human
immunogen :
F3 (AAH11029, a.a. 45-155) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
clone :
4G4
immunogen sequence :
(without GST)
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFY
TTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAG
EPLYENSPEFTPYLETNLGQPTIQSFEQVGTK*
TWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFY
TTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAG
EPLYENSPEFTPYLETNLGQPTIQSFEQVGTK*
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
company information

MilliporeSigma
questions and comments
