This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MilliporeSigma
other brands :
FLUKA, Sigma-Aldrich, Roche Applied Science
product type :
antibody
product name :
Anti-FRS3 antibody produced in rabbit
catalog :
SAB2103610
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dog, cow
application :
western blot
product information
cat no :
SAB2103610
brand :
SIGMA
name :
Anti-FRS3 antibody produced in rabbit
prod type :
Chemical
name suffix :
~1 mg/mL, affinity isolated antibody, lyophilized powder
storage :
-20C
storage temp :
-20C
physical form :
Antibody is lyophilized from PBS buffer with 2% sucrose.
ncbi accession no :
NM_006653
syns :
Anti-FRS2beta; Anti-FRS2B; Anti-MGC17167; Anti-SNT-2; Anti-SNT2
form :
lyophilized powder
antibody form :
affinity isolated antibody
application(s) :
western blot: suitable
species reactivity :
human, mouse, rat, rabbit, bovine, canine
concentration :
~1 mg/mL
immunogen :
Peptide region of the protein sequence according to NP_006644.
immunogen sequence :
GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSP
RVFNFDFRRPG
RVFNFDFRRPG
features and benefits :
Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
mol wt :
antigen mol wt ~40 kDa
company information

MilliporeSigma
questions and comments
