Anti-SIX2, (N-terminal) antibody produced in rabbit | MilliporeSigma SAB2103006 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

MilliporeSigma

other brands :

FLUKA, Sigma-Aldrich, Roche Applied Science

product type :

antibody

product name :

Anti-SIX2, (N-terminal) antibody produced in rabbit

catalog :

SAB2103006

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, chicken, bovine, zebrafish

application :

western blot, immunohistochemistry, ChIP-Seq

citations: 1

Published Application/Species/Sample/Dilution	Reference
ChIP-Seq; rat; fig 6 immunohistochemistry; rat; fig 9 western blot; rat; fig 9	Gao J, Kang X, Sun S, Li L, Zhang B, Li Y, et al. Transcription factor Six2 mediates the protection of GDNF on 6-OHDA lesioned dopaminergic neurons by regulating Smurf1 expression. Cell Death Dis. 2016;7:e2217 pubmed publisher

product information

cat no :

SAB2103006

brand :

SIGMA

name :

Anti-SIX2, (N-terminal) antibody produced in rabbit

prod type :

Chemical

name suffix :

~1 mg/mL, affinity isolated antibody, lyophilized powder

storage :

-20C

storage temp :

-20C

physical form :

Antibody is lyophilized from PBS buffer with 2% sucrose.

ncbi accession no :

NM_016932

form :

lyophilized powder

antibody form :

affinity isolated antibody

application(s) :

western blot: suitable

species reactivity :

canine, bovine, zebrafish, pig, chicken, human, mouse, rat,

concentration :

~1 mg/mL

immunogen :

Peptide region of the protein sequence according to NP_058628.

immunogen sequence :

WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESH
QFSPHNHAKLQ

features and benefits :

Antibody BioguaranteeEvaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

mol wt :

antigen mol wt ~27 kDa